Home » Products » Primary Antibodies » NEK9 Antibody (H00091754-M01) (0.1 mg)
 

NEK9 Antibody (H00091754-M01)

NEK9 Antibody (1F6)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
(see alternate names)
NEK9 Antibody (1F6) Summary:
Species:Hu, Mu, Rt
Applications:ELISA, IF, WB
Clonality:Monoclonal
Gene:NEK9
Purity:IgG purified
Host:Mouse
Specificity:NEK9 - NIMA (never in mitosis gene a)- related kinase 9
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional NEK9 Products
Antibody PairsLysates
Peptides and ProteinsPrimary Antibodies
RNAi
 
» View all NEK9 Related Products
NEK9 Antibody (1F6) Details:
Clone:1F6
Isotype:IgG2a Kappa
Immunogen:NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag.
Epitope:AGKGTPLTPPACACSSLQVEVERLQGLVLK CLAEQQKLQQENLQIFTQLQKLNKKLEGGQ QVGMHSKGTQTAKEEMEMDPKPDLDSDSWC LLGTDSCRPSL
Species Reactivity:

Human, Mouse, Rat. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: NEK9
Entrez91754 (Human)
OMIM609798, (Human)
Swiss ProtAAH09336 (Human)
 
Images (7)
  • Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.<br><br>Lane 1: NEK9 transfected lysate(107.2 KDa).<br>Lane 2: Non-transfected lysate.<br>
  • Immunofluorescence of monoclonal antibody to NEK9 (H00091754-M01) on HeLa cell . [antibody concentration 10 ug/ml]
  • NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7(Cat # L024V1 ).
  • NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3(Cat # L018V1 ).

See all images...

Reviews (0)

Be the first to review this product for a reward!

Related Products (19)

1 Antibody Pairs

2 Lysates

2 Peptides and Proteins

13 Primary Antibodies

1 RNAi

Secondary Antibodies

Exploring NEK9

3 Related Research Areas
Jump to: Images, Ask a Question

Working with NEK9

NEK9 Antibody (1F6) Images (7)
Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.

Lane 1: NEK9 transfected lysate(107.2 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence of monoclonal antibody to NEK9 (H00091754-M01) on HeLa cell . [antibody concentration 10 ug/ml]
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7(Cat # L024V1 ).NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3(Cat # L018V1 ).
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in PC-12(Cat # L012V1 ).NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa ( Cat # L013V1 ).
Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about NEK9? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
NEK9 Antibody PairH00091754-PW1HuIP, WB

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
NEK9 LysateH00091754-T01HuWB(2)

NEK9 LysateNBL1-13588WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
NEK9 Partial Recombinant ProteinH00091754-Q01HuELISA, WB(1)

NEK9 Recombinant ProteinH00091754-P01HuELISA, WB(1)

Primary Antibodies (13)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
NEK9 AntibodyNBP1-88007HuIF, IHC-P, WB(3)

NEK9 AntibodyNB100-58818Hu, MuIP, WB(1)

NEK9 AntibodyNB100-58817HuIP(1)

NEK9 [p Thr210] AntibodyNB100-78432HuIP, WB(2)(3)

NEK9 AntibodyNBP1-61748Hu, Mu, RtELISA, WB(1)

... and 8 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
NEK9 RNAiH00091754-R03Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »
Jump to: Novus Explorer, Research Areas

NEK9 in Context

Research Areas related to NEK9 (3):
Novus Explorer for NEK9 gene
Try our bioinformatic tool that shows the relationships between NEK9 and other genes, diseases, pathways and post-translational modifications.