MPZL2 Antibody (H00010205-B01P)

MPZL2 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
MPZL2 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:MPZL2
Purity:Protein A purified
Host:Mouse
Specificity:EVA1 - epithelial V-like antigen 1,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional MPZL2 Products
MPZL2 Antibody Details:
Immunogen:EVA1 (NP_005788.1, 1 a.a. ~ 215 a.a) full-length human protein.
Epitope:MYGKSSTRAVLLLLGIQLTALWPIAAVEIY TSRVLEAVNGTDARLKCTFSSFAPVGDALT VTWNFRPLDGGPEQFVFYYHIDPFQPMSGR FKDRVSWDGNPERYDASILLWKLQFDDNGT YTCQVKNPPDVDGVIGEIRLSVVHTVRFSE IHFLALAIGSACALMIIIVIVVVLFQHYRK KRWAERAHKVVEIKSKEEERLNQEKKVSVY LEDTD
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: MPZL2
Entrez10205 (Human)
Swiss ProtNP_005788.1 (Human)
 
Background:

Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with MPZL2

MPZL2 Antibody Images (1)
Western Blot analysis of EVA1 expression in transfected 293T cell line by EVA1 MaxPab polyclonal antibody.

Lane 1: EVA1 transfected lysate(23.65 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about MPZL2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
MPZL2 Antibody PairH00010205-PW1HuIP, WB

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
MPZL2 LysateNBL1-13215WB(1)

MPZL2 LysateH00010205-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
MPZL2 Recombinant ProteinH00010205-P01HuELISA, WB(1)

MPZL2 Partial Recombinant ProteinH00010205-Q01HuELISA, WB(1)

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
MPZL2 AntibodyNBP1-59230Hu, Mu, RtWB(1)

MPZL2 AntibodyH00010205-D01PHuELISA, WB(1)

MPZL2 AntibodyH00010205-D01HuIP

MPZL2 Antibody (2E10)H00010205-M06HuELISA

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

MPZL2 in Context


Novus Explorer for MPZL2 gene

Try our bioinformatic tool that shows the relationships between MPZL2 and other genes, diseases, pathways and post-translational modifications.