METAP2 Antibody (H00010988-B01P)
METAP2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MAP2 antibody, anti-p67eIF2 antibody, anti-p67 antibody, anti-MNPEP antibody, |
|
|
METAP2 Antibody Summary: | | Gene: | METAP2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | METAP2 - methionyl aminopeptidase 2, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
METAP2 Antibody Details: | Immunogen: | METAP2 (NP_006829.1, 1 a.a. ~ 478 a.a) full-length human protein. |
|---|
| Epitope: | MAGVEEVAASGSHLNGDLDPDDREEGAAST AEEAAKKKRRKKKKSKGPSAAGEQEPDKES GASVDEVARQLERSALEDKERDEDDEDGDG DGDGATGKKKKKKKKKRGPKVQTDPPSVPI CDLYPNGVFPKGQECEYPPTQDGRTAAWRT TSEEKKALDQASEEIWNDFREAAEAHRQVR KYVMSWIKPGMTMIEICEKLEDCSRKLIKE NGLNAGLAFPTGCSLNNCAAHYTPNAGDTT VLQYDDICKIDFGTH |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site. A pseudogene of this gene is located on chromosome 2. [provided by RefSeq]
|
|
Jump to: Images, Ask a Question
|
Working with METAP2
METAP2 Antibody Images (2) Western Blot analysis of METAP2 expression in transfected 293T cell line by METAP2 MaxPab polyclonal antibody.
Lane 1: METAP2 transfected lysate(52.58 KDa).
Lane 2: Non-transfected lysate.
|  METAP2 MaxPab polyclonal antibody. Western Blot analysis of METAP2 expression in human liver. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about METAP2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Secondary Antibodies
|
Related ProductsSecondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| METAP2 in Context
|
Novus Explorer for METAP2 gene
|
|
