MEF2B Antibody (1B6) Summary:

Species:	Hu
Applications:	ELISA
Clonality:	Monoclonal

Gene:	LOC729991-MEF2B
Purity:	IgG purified
Host:	Mouse

Specificity:	MEF2B - MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional MEF2B Products

Lysates	Peptides and Proteins
Primary Antibodies	RNAi

» View all MEF2B Related Products

MEF2B Antibody (1B6) Details:

Clone:	1B6
Isotype:	IgG2b Kappa
Immunogen:	MEF2B (AAH04449, 1 a.a. ~ 110 a.a) full length recombinant protein with GST tag.
Epitope:	MEEPEMQLKGKKVTDKFTESVYVLANEPSV ALYRLQEHVRRSLPELAQHKADMQRWEEQS QGAIYTVEYACSAVKNLVDSSVHFRSVEGL LKQAISIRDHMNASAQGHR*

Species Reactivity:

Human. Other species not tested.

Applications:

Uses:	Antibody reactive against recombinant protein on ELISA.
Dilutions:	ELISA
Unit Size:	0.1 mg
Concentration:	Please see the vial label for concentration.

Notes:

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging:

Storage:	Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:	In 1x PBS, pH 7.2
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: LOC729991-MEF2B

Entrez	4207 (Human)
OMIM	600661, (Human)
Swiss Prot	AAH04449 (Human)

Images (1)

See all images...

Reviews (0)

Be the first to review this product for a reward!

Working with MEF2B

MEF2B Antibody (1B6) Images (1)

Detection limit for recombinant GST tagged MEF2B is approximately 3ng/ml as a capture antibody.

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about MEF2B? Ask us by using live chat or by submitting your questions below:

Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
MEF2B Lysate	H00004207-T02	Hu	WB	(2)

Peptides and Proteins

Name	Catalog#	Reactivity	Applications	Images
MEF2B Recombinant Protein	H00004207-P02	Hu	ELISA, WB	(1)
MEF2B Recombinant Protein	H00004207-P01	Hu	ELISA, WB	(1)
MEF2B Partial Recombinant Protein	H00004207-Q01	Hu	ELISA, WB

Primary Antibodies (26)

Name	Catalog#	Reactivity	Applications	Images
MEF2B Antibody	NBP1-93440	Hu	IF, IHC-P, WB	(1)
MEF2B Antibody (1D8)	H00004207-M10	Hu	ELISA, IHC-P, WB	(3)
MEF2B Antibody	NBP1-55617	Hu, Mu	ELISA, WB	(1)
MEF2B Antibody (3D8)	H00004207-M09	Hu	ELISA, WB	(2)
MEF2B Antibody (4A2)	H00004207-M06	Hu	ELISA, IHC-P	(2)
... and 21 more. See All »

RNAi (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
MEF2B RNAi	H00004207-R01	Hu		(1)	(4)

Secondary Antibodies

Name	Catalog#	Reactivity	Applications	Publications
Mouse IgG Antibody [Biotin]	NB720-B	Mu	ELISA, IHC-P, WB
Mouse IgG Antibody [HRP]	NB720-H	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [Alkaline Phosphatase]	NB720-AP	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [FITC]	NB720-F	Mu	ICC, IHC-P	(2)
Mouse IgG Antibody	NB120-7056	Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)	ELISA, IHC-P, IP, WB
See All »

Jump to: Novus Explorer
MEF2B in Context
Novus Explorer for MEF2B gene

MEF2B Antibody (H00004207-M05)

MEF2B Antibody (1B6)