MDR1 Antibody (H00005243-M01)
MDR1 Antibody (1F11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ABC20 antibody, anti-PGY1 antibody, anti-P-GP antibody, anti-MDR1 antibody, anti-GP170 antibody, anti-CLCS antibody, anti-CD243 antibody, |
|
|
MDR1 Antibody (1F11) Summary: | | Gene: | ABCB1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ABCB1 - ATP-binding cassette, sub-family B (MDR/TAP), member 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional MDR1 Products MDR1 Antibody (1F11) Details: | Clone: | 1F11 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | ABCB1 (NP_000918, 620 a.a. ~ 710 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | GIYFKLVTMQTAGNEVELENAADESKSEID ALEMSSNDSRSSLIRKRSTRRSVRGSQAQD RKLSTKEALDESIPPVSFWRIMKLNLTEWP * |
|---|
Human. Other species not tested. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
|
Reviews (0) Related Products (18) Exploring MDR1
|
Jump to: Ask a Question
|
Working with MDR1
MDR1 Antibody (1F11) Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about MDR1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (10)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| MDR1 Antibody (C219) | NB600-1036 | Ca, Hu, Mk, Mu, Rt | ICC, IHC-Fr, IHC-P, IP, WB | | (6) | | | | MDR1 Antibody (PG-13) | NBP1-42581 | Hu | ICC, IF, IHC-Fr, IHC-P, IP, WB | | | | | | MDR1 Antibody (JSB-1) | NBP1-51768 | Ha, Mu(-), Rt(-) | FACS, IHC-Fr, IHC-P, WB | | | | | | MDR1 Antibody | NBP1-90291 | Hu | IF, IHC-P, WB | (1) | | | | | MDR1 Antibody | NB100-80870 | Ca, Hu, Mk, Mu(-), Rt | ELISA, IHC-P, WB | (1) | | | | | ... and 5 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
