MDM1 Antibody 0.1 ml

Click image to view larger
Western Blot: MDM1 Antibody [NBP1-85839] - WB for MDM1 in 293T cells. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MDM1 Antibody [NBP1-85839] - Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & centrosome.
Immunohistochemistry-Paraffin: MDM1 Antibody [NBP1-85839] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: MDM1 Antibody [NBP1-85839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Download Datasheet
See All Related

Ordering Information: NBP1-85839

  • Catalog Number
    NBP1-85839
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

MDM1 Antibody Summary

Species Human
Tested Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
MDM1
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

MDM1 Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQTLARAKKRKEN

Species Reactivity

Human
Reviewed Species Read 1 rated 4
using NBP1-85839 in the following species:

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
MDM1 Protein (NBP1-85839PEP)
Reviewed Applications
Read 1 rated 4
using
NBP1-85839 in the following applications:

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Average Rating: 4
Recent Reviews
WB Tested In Human
Reviewed On: 07/02/2014
Rated: 4

MDM1 NBP1-85839
Image 1 of 1
Earn rewards points by submitting your review for MDM1 Antibody (NBP1-85839)

Publications

Earn rewards if you have published using MDM1 Antibody (NBP1-85839).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol MDM1

Alternate Names for MDM1 Antibody

  • FLJ95264
  • Mdm1 nuclear protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
  • nuclear protein double minute 1
  • nuclear protein MDM1
Show More

Related Products by Gene


Reviews for MDM1 Antibody (NBP1-85839) (1) 41

Read what people are saying who have used MDM1 Antibody (NBP1-85839).

We have 1 review tested in 1 species: Human.
We have 1 review tested in 1: Western Blot.
Average Rating: 4
(Based on 1 reviews)

Have you used MDM1 Antibody (NBP1-85839)? Submit your review and earn rewards points which can be used for merchandise & discounts.

Sort 1 reviews for MDM1 Antibody (NBP1-85839) by:
Filter by Ratings
Very Good
(1)
All Ratings
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species

Images Ratings Applications Species Reviewed By Date Details
Western Blot MDM1 NBP1-85839
Click to Enlarge
Very Good
WB Human Anatoli Grechov 07/02/2014
Show

Summary

ApplicationWestern Blot
Sample Tested293T lysates
Sample Pretreatment30 ug SDS lysate
SpeciesHuman

Blocking

Blocking Details5% BSA in PBS

Primary Anitbody

Dilution Ratio1:1000 diluted in PBS with triton X-100, blot was incubated at room temperature on a rocker

Secondary Antibody

Secondary Manufacturer Cat#111-005-045
Secondary Concentration1:20000

Details

Detection NotesProbed using Visualizer Western Blot Detection Kit (Millipore) and captured on X-ray films, 30 sec exposure

Publications for MDM1 Antibody (NBP1-85839) (0)

There are no publications for MDM1 Antibody (NBP1-85839).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using MDM1 Antibody (NBP1-85839)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for MDM1 (3)

  1. I used an Ab NBP-1 85839 from your company in NSLC cells for western and am wondering what the expected size of this protein should be.
    • The MDM1 protein has an expected molecular weight of 80kDa. There are four isoforms to this protein and our product NBP1-85839 is capable of detecting isoforms 1 and 4 (80 and 76kDa respectively). uniprot site In western blot, our lab has detected bands from 70-78kDa. Since there is a phophoserine residue at amino acid 83, it is possible to detect bands up to 80-85kDa.
  2. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  3. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NB100-2736
Western Blot: MDM2/HDM2 Antibody (SMP14) [NB100-2736] - Daudi whole cell protein was separated by SDS-PAGE on a 7.5% gel and transferred to PVDF membrane. The membrane was probed with anti-MDM2 antibody at 2 ug/ml and detected with an anti-mouse HRP secondary antibody using chemiluminescence.Immunohistochemistry-Paraffin: MDM2/HDM2 Antibody (SMP14) [NB100-2736] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MDM2/HDM2 antibody (clone SMP14) at 1:100 dilution. Several of the cancer cells developed a strong nuclear with weak cytoplasmic immunostaining of MDM2.Immunohistochemistry-Paraffin: MDM2/HDM2 Antibody (SMP14) [NB100-2736] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MDM2/HDM2 antibody (clone SMP14) at 1:100 dilution. Several of the cancer cells developed a strong nuclear with weak cytoplasmic immunostaining of MDM2.

Mouse Monoclonal
Species Human, Rat
Applications WB, IHC, IHC-Fr...MORE

     1 Review

16 Publications
MAB285
IFN‑ gamma  was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with PMA and ionomycin using 10 µg/mL Human IFN‑ gamma  Monoclonal Antibody (Catalog # MAB285) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.Recombinant Human IFN‑ gamma  (Catalog # 285-IF) reduces the Encephalomyocarditis Virus (EMCV)-induced cytopathy in the HeLa human cervical epithelial carcinoma cell line in a dose-dependent manner (orange line), as measured by crystal violet staining. Inhibition of EMCV activity elicited by Recombinant Human IFN‑ gamma  (5 ng/mL) is neutralized (green line) by increasing concentrations of Human IFN‑ gamma  Monoclonal Antibody (Catalog # MAB285). The ND50 is typically 0.02-0.06 µg/mL.

Mouse Monoclonal
Species Human
Applications ICC, Neut

11 Publications
NBP1-32728
Western Blot: SUCLG1 Antibody [NBP1-32728] - Sample (30 ug of whole cell lysate) A: A431 10% SDS PAGE, antibody diluted at 1:1000.Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-32728] - Paraffin-embedded N87 xenograft, using antibody at 1:100 dilution.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

H00055835-M02
Western Blot: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ expression in transfected 293T cell line by CENPJ monoclonal antibody (M02), clone 1A5.Lane 1: CENPJ transfected lysate(43.2 KDa).Lane 2: Non-transfected lysate.Immunoprecipitation: CENPJ Antibody (1A5) [H00055835-M02] - Analysis of CENPJ transfected lysate using anti-CENPJ monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CENPJ MaxPab rabbit polyclonal antibody.Sandwich ELISA: CENPJ Antibody (1A5) [H00055835-M02] - Detection limit for recombinant GST tagged CENPJ is 0.1 ng/ml as a capture antibody.

Mouse Monoclonal
Species Human
Applications WB, ELISA, IP...MORE

NBP2-34061
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - liverImmunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - breast cancer

Rabbit Polyclonal
Species Human
Applications IHC, IHC-P

NBP1-31370
Western Blot: ERG Antibody [NBP1-31370] - A. 30 ug HeLa whole cell lysate/extract, B. 30 ug HepG2 whole cell lysate/extract 10 % SDS-PAGE gel, antibody dilution 1:1000.Immunocytochemistry/Immunofluorescence: ERG Antibody [NBP1-31370] - Analysis of HeLa, using NBP1-31370 at 1:200 dilution.Western Blot: ERG Antibody [NBP1-31370] - 30 ug Raw264. 7 whole lysate/extract 10% SDS-PAGE gel, antibody dilution 1:1000.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF

NBP1-52030
Western Blot: MYF6 Antibody [NBP1-52030] - HEK293 lysate (10ug protein in RIPA buffer) overexpressing Human MYF6 with MYC tag probed with EB09957 (0.5ug/ml) in Lane A and probed with anti-MYC Tag (1/1000) in lane C. Mock-transfected HEK293 probed with EB09957 (0.5mg/ml) in Lane B. Primary incubations were for 1 hour. Detected by chemiluminescence.

Goat Polyclonal
Species Human
Applications WB, PEP-ELISA

1 Publication
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - IHC-P analysis of a formalin fixed paraffin embedded mouse brain section using GLI-1 antibody at 1:600 dilution.   Flow (Intracellular): GLI-1 Antibody [NB600-600] - intracellular staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1)  using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ChIP, ELISA...MORE

14 Publications
NBP2-31983
Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunohistochemical staining of human lymph node shows distinct nuclear positivity in non-germinal center cells.Immunohistochemistry: SP4 Antibody [NBP2-31983] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & cytoplasm.

Rabbit Polyclonal
Species Human
Applications ICC/IF, IHC

NBP1-54974
Western Blot: NEDD4L Antibody [NBP1-54974] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB

NB100-64387

Rat Monoclonal
Species Mouse
Applications B/N, ELISA, Func...MORE

3 Publications
NBP1-86658
Western Blot: PICALM Antibody [NBP1-86658] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunocytochemistry/Immunofluorescence: PICALM Antibody [NBP1-86658] - Staining of human cell line U-251 MG shows positivity in vesicles. Antibody staining is shown in green.  Immunohistochemistry-Paraffin: PICALM Antibody [NBP1-86658] - Staining of human duodenum shows strong positivity in glandular cells.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

1 Publication
NB100-1591
Immunoprecipitation: UBR5/EDD Antibody [NB100-1591] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug) and Jurkat (J; 50 ug) cells. Antibodies: Affinity purified rabbit anti-EDD1 antibody NBP2-04104 used for WB at 0.4 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. EDD1 was also immunoprecipitated by rabbit anti-EDD1 antibodies NBP1-71802, which recognizes a downstream epitope, and NB100-1591, which recognizes a similar epitope. Detection: Chemiluminescence with exposure times of 10 seconds (A and B).

Rabbit Polyclonal
Species Human, Mouse
Applications IP (-), WB

6 Publications
NB100-56736
Western Blot: RGS2 Antibody [NB100-56736] - Western bot analysis of RGS2 in human heart lysate using RGS2 antibody at 2 ug/ml.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB

H00000667-M01
Immunocytochemistry/Immunofluorescence: Dystonin Antibody (1B10) [H00000667-M01] - Analysis of monoclonal antibody to DST on HeLa cell. Antibody concentration 10 ug/ml.Sandwich ELISA: Dystonin Antibody (1B10) [H00000667-M01] - Detection limit for recombinant GST tagged DST is approximately 0.1ng/ml as a capture antibody.

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

1 Publication
NBP1-56853
Western Blot: RPE Antibody [NBP1-56853] - Human Muscle lysate, concentration 0.2-1 ug/ml.Immunocytochemistry/Immunofluorescence: RPE Antibody [NBP1-56853] - Antibody  0 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver  Observed Staining: Cytoplasm but only in connective tissue cells in the interlobular septum, very low tissue distribution Primary Antibody

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF

H00003447-T01
IFNA13 transfected lysate.Lane 1: IFNA13 transfected lysate (20.9 KDa) Lane 2: Non-transfected lysate.


Species Human
Applications WB

Bioinformatics Tool for MDM1

Discover related pathways, diseases and genes to MDM1. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

PTMs for MDM1

Learn more about PTMs related to MDM1.

Blogs on MDM1

There are no specific blogs for MDM1, but you can read our latest blog posts.