MDM1 Antibody 0.1 ml

MDM1 NBP1-85839

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-85839

  • All MDM1 Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-85839

Catalog NumberNBP1-85839
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

MDM1 Antibody Summary

 
Species Human
Tested Applications WB, ICC/IF, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene MDM1
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

MDM1 Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQ HNVGKARMNNLQLPQHEAFNDEDEDRLSEISARSAASSLRAFQT LARAKKRKEN

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:2000
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes

For IHC-Paraffin HIER pH6 retrieval is recommended.

Product PDFs

Reviews

Earn rewards points by submitting your review for MDM1 Antibody (NBP1-85839).
Submit a Review

Publications

Earn rewards if you have published using MDM1 Antibody (NBP1-85839).
Submit a Publication

Controls & Support Products

Research Tools

View all MDM1 Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol MDM1

Alternate Names for MDM1

 
  • nuclear protein MDM1
  • nuclear protein double minute 1
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
  • FLJ95264
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
  • Mdm1 nuclear protein homolog (mouse)

Related Products by Gene