Lamin B Receptor Antibody (H00003930-B01P)
Lamin B Receptor Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-DHCR14B antibody, anti-PRO0650 antibody, anti-PHA antibody, anti-MGC9041 antibody, anti-LMN2R antibody, |
|
|
Lamin B Receptor Antibody Summary: | | Gene: | LBR |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Lamin B Receptor Products Lamin B Receptor Antibody Details: | Immunogen: | LBR (NP_002287.2, 1 a.a. ~ 615 a.a) full-length human protein. |
|---|
| Epitope: | MPSRKFADGEVVRGRWPGSSLYYEVEILSH DSTSQLYTVKYKDGTELELKENDIKPLTSF RQRKGGSTSSSPSRRRGSRSRSRSRSPGRP PKSARRSASASHQADIKEARREVEVKLTPL ILKPFGNSISRYNGEPEHIERNDAPHKNTQ EKFSLSQESSYIATQYSLRPRREEVKLKEI DSKEEKYVAKELAVRTFEVTPIRAKDLEFG GVPGVFLIMFGLPVFLFLLLLMCKQKDPSL LNFPPPLPALYELWE |
|---|
| Uses: | This antibody is useful for ELISA, immunofluorescence, immunohistochemistry (paraffin) and Western Blot. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq]
|
Images (3) Reviews (0) Related Products (10)
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| Lamin B Receptor in Context
|
Novus Explorer for Lamin B Receptor gene
|
|
![Immunoperoxidase of <u>purified</u> MaxPab antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00003930-B01P-3-36-1-S.jpg "Immunoperoxidase of <u>purified</u> MaxPab antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]")
![Immunofluorescence of <u>purified</u> MaxPab antibody to LBR on HeLa cell. [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00003930-B01P-4-1-1-S.jpg "Immunofluorescence of <u>purified</u> MaxPab antibody to LBR on HeLa cell. [antibody concentration 10 ug/ml]")
