LXR alpha Antibody (H00010062-D01P)
LXR alpha Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-LXR-a antibody, anti-RLD-1 antibody, anti-LXRa antibody, |
|
|
LXR alpha Antibody Summary: | | Gene: | NR1H3 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with nuclear receptor subfamily 1, group H, member 3. |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LXR alpha Products LXR alpha Antibody Details: | Immunogen: | NR1H3 (AAH41172.1, 1 a.a. ~ 402 a.a) full-length human protein. |
|---|
| Epitope: | MPHSAGGTAGVGLEAAEPTALLTRAEPPSE PTEIRPQKRKKGPAPKMLGNELCSVCGDKA SGFHYNVLSCEGCKGFFRRSVIKGAHYICH SGGHCPMDTYMRRKCQECRLRKCRQAGMRE ECVLSEEQIRLKKLKRQEEEQAHATSLPPR ASSPPQILPQLSPEQLGMIEKLVAAQQQCN RRSFSDRLRVTPWPMAPDPHSREARQQRFA HFTELAIVSVQEIVDFAKQLPGFLQLSRED QIALLKTSAIEVMLL |
|---|
| Uses: | This antibody is reactive against cell and transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (2) Reviews (0) Related Products (16) Exploring LXR alpha
|
Jump to: Images, Ask a Question
|
Working with LXR alpha
LXR alpha Antibody Images (2) Western Blot analysis of NR1H3 expression in transfected 293T cell line by NR1H3 MaxPab rabbit polyclonal antibody.
Lane 1: NR1H3 transfected lysate(45.70 KDa).
Lane 2: Non-transfected lysate.
|  NR1H3 MaxPab rabbit polyclonal antibody. Western Blot analysis of NR1H3 expression in A-431. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LXR alpha? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (10)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
