LXR alpha Antibody (H00010062-B01P)

LXR alpha Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
LXR alpha Antibody Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Polyclonal
Gene:NR1H3
Purity:Protein A purified
Host:Mouse
Specificity:Reacts with nuclear receptor subfamily 1, group H, member 3.
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional LXR alpha Products
LXR alpha Antibody Details:
Immunogen:NR1H3 (AAH41172.1, 1 a.a. ~ 402 a.a) full-length human protein.
Epitope:MPHSAGGTAGVGLEAAEPTALLTRAEPPSE PTEIRPQKRKKGPAPKMLGNELCSVCGDKA SGFHYNVLSCEGCKGFFRRSVIKGAHYICH SGGHCPMDTYMRRKCQECRLRKCRQAGMRE ECVLSEEQIRLKKLKRQEEEQAHATSLPPR ASSPPQILPQLSPEQLGMIEKLVAAQQQCN RRSFSDRLRVTPWPMAPDPHSREARQQRFA HFTELAIVSVQEIVDFAKQLPGFLQLSRED QIALLKTSAIEVMLL
Species Reactivity:

Human

Applications:
Uses:This antibody is reactive against tissue and transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500,
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Store at -20 °C. Avoid freeze-thaw cycles.
Buffer:1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: NR1H3
Entrez10062 (Human)
Swiss ProtAAH41172.1 (Human)
 
Jump to: Images, Ask a Question

Working with LXR alpha

LXR alpha Antibody Images (3)
Western Blot analysis of NR1H3 expression in transfected 293T cell line by NR1H3 MaxPab polyclonal antibody.

Lane 1: NR1H3 transfected lysate(44.22 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence of purified MaxPab antibody to NR1H3 on HeLa cell. [antibody concentration 10 ug/ml]
NR1H3 MaxPab polyclonal antibody. Western Blot analysis of NR1H3 expression in human liver.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about LXR alpha? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
LXR alpha LysateNBL1-13768WB(1)

LXR alpha LysateH00010062-T01WB

LXR alpha LysateH00010062-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
LXR alpha Recombinant ProteinH00010062-P01HuELISA, WB(1)

LXR alpha PeptideNBP1-77106PEPHuB/N

Primary Antibodies (9)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
LXR alpha AntibodyNBP1-92086HuIF, IHC-P, WB(2)

LXR alpha AntibodyNB300-612HuWB(4)

LXR alpha AntibodyNBP1-77106Hu, Mu, RtELISA, IHC-P, WB(2)

LXR alpha AntibodyH00010062-D01PHuELISA, WB(2)

LXR alpha AntibodyNB100-74456MuWB(1)

... and 4 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
LXR alpha RNAiH00010062-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

LXR alpha in Context


Research Areas related to LXR alpha (1):
Novus Explorer for LXR alpha gene

Try our bioinformatic tool that shows the relationships between NR1H3 and other genes, diseases, pathways and post-translational modifications.