LXR alpha Antibody (H00010062-B01)
LXR alpha Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-LXR-a antibody, anti-RLD-1 antibody, anti-LXRa antibody |
|
|
LXR alpha Antibody Summary: | | Gene: | NR1H3 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | NR1H3 - nuclear receptor subfamily 1, group H, member 3, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LXR alpha Products LXR alpha Antibody Details: | Immunogen: | NR1H3 (-, 1 a.a. ~ 402 a.a) full-length human protein. |
|---|
| Epitope: | MPHSAGGTAGVGLEAAEPTALLTRAEPPSE PTEIRPQKRKKGPAPKMLGNELCSVCGDKA SGFHYNVLSCEGCKGFFRRSVIKGAHYICH SGGHCPMDTYMRRKCQECRLRKCRQAGMRE ECVLSEEQIRLKKLKRQEEEQAHATSLPPR ASSPPQILPQLSPEQLGMIEKLVAAQQQCN RRSFSDRLRVTPWPMAPDPHSREARQQRFA HFTELAIVSVQEIVDFAKQLPGFLQLSRED QIALLKTSAIEVMLL |
|---|
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for immunofluorescence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500, |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This antibody is in antisera and the concentration is unavailable. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (3) Reviews (0) Related Products (16) Exploring LXR alpha
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (9)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of <u>purified</u> MaxPab antibody to NR1H3 on HeLa cell. [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00010062-B01-4-1-1-S.jpg "Immunofluorescence of <u>purified</u> MaxPab antibody to NR1H3 on HeLa cell. [antibody concentration 10 ug/ml]")
