LDL Receptor Antibody (H00003949-M01)
LDL Receptor Antibody (5E7)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-FH antibody, anti-FHC antibody, |
|
|
LDL Receptor Antibody (5E7) Summary: | | Gene: | LDLR |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | LDLR - low density lipoprotein receptor (familial hypercholesterolemia) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LDL Receptor Products LDL Receptor Antibody (5E7) Details: | Clone: | 5E7 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | LDLR (NP_000518, 105 a.a. ~ 206 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | PPKTCSQDEFRCHDGKCISRQFVCDSDRDC LDGSDEASCPVLTCGPASFQCNSSTCIPQL WACDNDPDCEDGSDEWPQRCRGLYVFQGDS SPCSAFEFHCL* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. It has also been used for Western Blot. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| TMW: | 96 kDa |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia.
|
Images (2) Reviews (0) Related Products (31) Exploring LDL Receptor
|
Jump to: Images, Ask a Question
|
Working with LDL Receptor
LDL Receptor Antibody (5E7) Images (2) Western Blot analysis of LDLR expression in transfected 293T cell line by LDLR monoclonal antibody (M01), clone 5E7.
Lane 1: LDLR transfected lysate(94.6 KDa).
Lane 2: Non-transfected lysate.
|  Detection limit for recombinant GST tagged LDLR is approximately 0.3ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LDL Receptor? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (21)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| LDL Receptor Antibody (C7) | NBP1-78159 | Bv, Hu | ICC, IF, IHC-P, IP, WB | (2) | (6) | | | | LDL Receptor Antibody | NBP1-06709 | Hu, Mk, Mu | WB | (1) | (3) | | | | LDL Receptor Antibody (EP1553Y) | NB110-57162 | Hu, Mu, Rt | FACS, ICC, IHC-P, IP, WB | (3) | (3) | | | | LDL Receptor Antibody | NBP1-87476 | Hu | IF, IHC-P, WB | (2) | | | | | LDL Receptor Antibody | NBP1-87579 | Hu | IF, IHC-P, WB | (1) | | | | | ... and 16 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| LDL Receptor in Context
Research Areas related to LDL Receptor (2): |
|
Novus Explorer for LDL Receptor gene
|
|
