LCAT Antibody (H00003931-D01P)
LCAT Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
LCAT Antibody Summary: | | Gene: | LCAT |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with lecithin-cholesterol acyltransferase. |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LCAT Products LCAT Antibody Details: | Immunogen: | LCAT (NP_000220.1, 1 a.a. ~ 440 a.a) full-length human protein. |
|---|
| Epitope: | MGPPGSPWQWVTLLLGLLLPPAAPFWLLNV LFPPHTTPKAELSNHTRPVILVPGCLGNQL EAKLDKPDVVNWMCYRKTEDFFTIWLDLNM FLPLGVDCWIDNTRVVYNRSSGLVSNAPGV QIRVPGFGKTYSVEYLDSSKLAGYLHTLVQ NLVNNGYVRDETVRAAPYDWRLEPGQQEEY YRKLAGLVEEMHAAYGKPVFLIGHSLGCLH LLYFLLRQPQAWKDRFIDGFISLGAPWGGS IKPMLVLASGDNQGI |
|---|
| Uses: | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (9) Exploring LCAT
|
Jump to: Images, Ask a Question
|
Working with LCAT
LCAT Antibody Images (1) Western Blot analysis of LCAT expression in transfected 293T cell line by LCAT MaxPab rabbit polyclonal antibody.
Lane 1: LCAT transfected lysate(49.60 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LCAT? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
