LCAT Antibody (H00003931-A01)
LCAT Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
LCAT Antibody Summary: | | Gene: | LCAT |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | LCAT - lecithin-cholesterol acyltransferase |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LCAT Products LCAT Antibody Details: | Immunogen: | LCAT (AAH14781, 98 a.a. ~ 197 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | CWIDNTRVVYNRSSGLVSNAPGVQIRVPGF GKTYSVEYLDSSKLAGYLHTLVQNLVNNGY VRDETVRAAPYDWRLEPGQQEEYYRKLAGL VEEMHAAYGK |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
|
Images (1) Reviews (0) Related Products (9) Exploring LCAT
|
Jump to: Images, Ask a Question
|
Working with LCAT
LCAT Antibody Images (1) LCAT polyclonal antibody (A01), Lot # 051115JC01 Western Blot analysis of LCAT expression in MCF-7 ( Cat # L046V1 ). |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LCAT? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
