LC3C Antibody (H00440738-B01)
LC3C Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
LC3C Antibody Summary: | | Gene: | MAP1LC3C |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | MAP1LC3C - microtubule-associated protein 1 light chain 3 gamma, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LC3C Products LC3C Antibody Details: | Immunogen: | MAP1LC3C (NP_001004343, 1 a.a. ~ 147 a.a) full-length human protein. |
|---|
| Epitope: | MPPPQKIPSVRPFKQRKSLAIRQEEVAGIR AKFPNKIPVVVERYPRETFLPPLDKTKFLV PQELTMTQFLSIIRSRMVLRATEAFYLLVN NKSLVSMSATMAEIYRDYKDEDGFVYMTYA SQETFGCLESAAPRDGSSLEDRPCNPL |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Autophagy is a highly regulated bulk degradation process that plays an important role in cellular maintenance and development. MAP1LC3C is 1 of 3 orthologs of the yeast autophagosome protein Atg8 (He et al., 2003 [PubMed 12740394]).[supplied by OMIM]
|
Images (1) Reviews (0) Related Products (7) Exploring LC3C
|
Jump to: Images, Ask a Question
|
Working with LC3C
LC3C Antibody Images (1) Western Blot analysis of MAP1LC3C expression in transfected 293T cell line by MAP1LC3C MaxPab polyclonal antibody.
Lane 1: MAP1LC3C transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LC3C? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (4)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
