Kallikrein 6 Antibody (H00005653-M01)

Kallikrein 6 Antibody (4A10)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
Kallikrein 6 Antibody (4A10) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:KLK6
Purity:IgG purified
Host:Mouse
Specificity:KLK6 (4A10)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Kallikrein 6 Products
Kallikrein 6 Antibody (4A10) Details:
Clone:4A10
Isotype:IgG2a Kappa
Immunogen:KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Epitope:RAVIHPDYDAASHDQDIMLLRLARPAKLSE LIQPLPLERDCSANTTSCHILGWGKTADGD FPDTIQCAYIHLVSREECEHAYPGQITQNM LCAGDEKYGK
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: KLK6
Entrez5653 (Human)
OMIM602652, (Human)
Swiss ProtAAH15525 (Human)
 
Background:

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene.

Jump to: Images, Ask a Question

Working with Kallikrein 6

Kallikrein 6 Antibody (4A10) Images (1)
Detection limit for recombinant GST tagged KLK6 is approximately 0.3ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Kallikrein 6? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Kallikrein 6 LysateNBL1-12354WB(1)

Kallikrein 6 LysateNBL1-12355WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Kallikrein 6 Partial Recombinant ProteinH00005653-Q01HuELISA, WB(1)(1)

Kallikrein 6 Recombinant ProteinH00005653-P01HuELISA, WB(1)

Kallikrein 6 ProteinNBP1-74344WB

Kallikrein 6 ProteinNBP1-74345WB

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Kallikrein 6 AntibodyNBP1-06497HuWB(1)(4)

Kallikrein 6 AntibodyNBP1-51939Bv, Mu, RtPEP-ELISA, WB

Kallikrein 6 Antibody33510002HuELISA(1)

Kallikrein 6 AntibodyNBP1-54713HuWB(1)

RNAi (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Kallikrein 6 RNAiH00005653-R01Hu(1)(4)

Kallikrein 6 RNAiH00005653-R02Hu(1)(4)

Kallikrein 6 RNAiH00005653-R03Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Kallikrein 6 in Context


Research Areas related to Kallikrein 6 (2):
Novus Explorer for Kallikrein 6 gene

Try our bioinformatic tool that shows the relationships between KLK6 and other genes, diseases, pathways and post-translational modifications.