KRAS Antibody (H00003845-M02)

KRAS Antibody (4F3)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
KRAS Antibody (4F3) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:KRAS
Purity:IgG purified
Host:Mouse
Specificity:KRAS - v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional KRAS Products
KRAS Antibody (4F3) Details:
Clone:4F3
Isotype:IgG2a Kappa
Immunogen:KRAS (NP_004976, 16 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Epitope:KSALTIQLIQNHFVDEYDPTIEDSYRKQVV IDGETCLLDILDTAGQEEYSAMRDQYMRTG EGFLCVFAINNTKSFEDIHHYREQIKRVKD SEDVPMVLVGNKCDLPSRTV*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Positive Controls:1 Positive Controls
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: KRAS
Entrez3845 (Human)
OMIM109800, 114480,
Swiss ProtNP_004976 (Human)
 
Background:

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.

Jump to: Images, Ask a Question

Working with KRAS

KRAS Antibody (4F3) Images (3)
Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M02), clone 4F3.

Lane 1: KRAS transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
KRAS monoclonal antibody (M02), clone 4F3 Western Blot analysis of KRAS expression in HeLa ( Cat # L013V1 ).
Detection limit for recombinant GST tagged KRAS is approximately 0.3ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about KRAS? Ask us by using live chat or by submitting your questions below:

 
Jump to: Positive Controls, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Positive Controls
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Hela Whole Cell LysateNB800-PC1WB(2)

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
KRAS LysateL135T6HuIP, WB(2)

KRAS LysateNBL1-12376WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
KRAS ProteinNBP1-45274HuELISA, PAGE(1)(2)

KRAS Partial Recombinant ProteinH00003845-Q01HuELISA, WB(1)

KRAS Recombinant ProteinH00003845-P01HuELISA, WB(1)

Primary Antibodies (8)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
KRAS AntibodyNBP1-58261ACF, Dr, Hu, Mu, RtIHC-P, WB(3)

KRAS Antibody (3B10-2F2)H00003845-M01HuELISA, IF, WB(3)(1)

KRAS AntibodyNBP1-36054HuIHC-P(1)

KRAS Antibody (4B6)H00003845-M03HuELISA, WB

KRAS Antibody (4E2)H00003845-M04HuELISA, WB

... and 3 more. See All »
RNAi (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
KRAS RNAiH00003845-R01Hu(1)(4)

KRAS RNAiH00003845-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

KRAS in Context


Research Areas related to KRAS (4):
Novus Explorer for KRAS gene

Try our bioinformatic tool that shows the relationships between KRAS and other genes, diseases, pathways and post-translational modifications.