Intra Acrosomal Protein Antibody (H00000056-B01)

Intra Acrosomal Protein Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
Intra Acrosomal Protein Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ACRV1
Purity:Whole antisera
Host:Mouse
Specificity:ACRV1 - acrosomal vesicle protein 1,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Intra Acrosomal Protein Products
Intra Acrosomal Protein Antibody Details:
Immunogen:ACRV1 (AAH14588, 1 a.a. ~ 266 a.a) full-length human protein.
Epitope:MNRFLLLMSLYLLGPARGTSSQPNELSGSI DHQTSVQQLPGEFFSLENPSDAEALYETSS GLNTLSEHGSSEHGSSKHTVAEHTSGEHAE SEHASGEPAATEHAEGEHTVGEQPSGEQPS GEHLSGEQPLSELESGEQPSDEQPSGEHGS GEQPSGEQASGEQPSGEHASGEQASGAPIS STSTGTILNCYTCAYMNDQGKCLRGEGTCI TQNSQQCMLKKIFEGGKLQFMVQGCENMCP SMNLFSHGTRMQIIC
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Positive Controls:2 Positive Controls
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ACRV1
Entrez56 (Human)
Swiss ProtAAH14588 (Human)
 
Background:

This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Jump to: Images, Ask a Question

Working with Intra Acrosomal Protein

Intra Acrosomal Protein Antibody Images (1)
Western Blot analysis of ACRV1 expression in transfected 293T cell line by ACRV1 MaxPab polyclonal antibody (B01).

Lane 1: ACRV1 transfected lysate(29.26 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Intra Acrosomal Protein? Ask us by using live chat or by submitting your questions below:

 
Jump to: Positive Controls, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Positive Controls
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Intra Acrosomal Protein LysateH00000056-T01HuWB(2)

Other Positive Controls
  • H00000056-T01
Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Intra Acrosomal Protein LysateH00000056-T01HuWB(2)

Intra Acrosomal Protein LysateNBL1-07257WB(1)

Intra Acrosomal Protein LysateH00000056-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Intra Acrosomal Protein Recombinant ProteinH00000056-P01HuELISA, WB(1)

Primary Antibodies (18)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Intra Acrosomal Protein AntibodyNBP1-88038HuIF, IHC-P, WB(2)

Intra Acrosomal Protein Antibody (Hs-8)NB500-456Hu, Po(-)FACS, ICC, WB(2)

Intra Acrosomal Protein Antibody (Hs-14)NB500-455Hu, MuFACS, ICC, WB(1)

Intra Acrosomal Protein Antibody (Hs-14)MAB3824Hu, MuFACS, ICC, IF, WB

Intra Acrosomal Protein Antibody (ACR-4)NB500-435Bv, PoICC, WB(1)

... and 13 more. See All »
RNAi (9)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Intra Acrosomal Protein RNAiH00000056-R07Hu(1)(4)

Intra Acrosomal Protein RNAiH00000056-R05Hu(1)(4)

Intra Acrosomal Protein RNAiH00000056-R01Hu(1)(4)

Intra Acrosomal Protein RNAiH00000056-R08Hu(1)(4)

Intra Acrosomal Protein RNAiH00000056-R06Hu(1)(4)

... and 4 more. See All »
Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

Intra Acrosomal Protein in Context


Novus Explorer for Intra Acrosomal Protein gene

Try our bioinformatic tool that shows the relationships between ACRV1 and other genes, diseases, pathways and post-translational modifications.