Integrin alpha D/CD11d Antibody 0.1 ml

Click image to view larger
Immunohistochemistry-Paraffin: CD11d Antibody [NBP1-90237] - Immunohistochemical staining of human bone marrow shows distinct cytoplasmic positivity in a subset of bone marrow poietic cells.
Download Datasheet
See All Related

Ordering Information: NBP1-90237

  • Catalog Number
    NBP1-90237
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

Integrin alpha D/CD11d Antibody Summary

Species Human
Tested Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAD
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Integrin alpha D/CD11d Antibody Details

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLV

Species Reactivity

Expected identity based on immunogen sequence: Mouse (76%), Rat (77%)

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Positive Controls

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for Integrin alpha D/CD11d Antibody (NBP1-90237). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using Integrin alpha D/CD11d Antibody (NBP1-90237).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol ITGAD
Entrez
Uniprot

Alternate Names for Integrin alpha D/CD11d Antibody

  • ADB2
  • CD11 antigen-like family member D
  • CD11D
  • FLJ39841
  • integrin alpha-D
  • integrin, alpha D
  • leukointegrin alpha D
Show More

Related Products by Gene


Reviews for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no reviews for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Integrin alpha D/CD11d Antibody (NBP1-90237)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no publications for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Integrin alpha D/CD11d Antibody (NBP1-90237)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Integrin alpha D/CD11d (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NB110-57163
Western Blot: Integrin beta 2/CD18 [p Ser745] Antibody (EP1288Y) [NB110-57163] Jurkat cell lysates, 1:500 dilution. Cells were either (A) untreated (B) treated with AP.Immunocytochemistry/Immunofluorescence: Integrin beta 2/CD18 [p Ser745] Antibody (EP1288Y) [NB110-57163] - Stained Raw 246.7 cells. Immunohistochemistry-Paraffin: Integrin beta 2/CD18 [p Ser745] Antibody (EP1288Y) [NB110-57163] - Immunohistochemical analysis of human tonsils using anti-Phospho- LFA-b2 (pS745) (NB110-57163).

Rabbit Monoclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

2 Publications
NBP1-67921
Western Blot: LTBR Antibody [NBP1-67921] - Analysis of extracts from HeLa/HepG2 cells, using LTBR Antibody. The lane on the right is treated with the synthesized peptide.Immunocytochemistry/Immunofluorescence: LTBR Antibody [NBP1-67921] - Analysis of HeLa cells, using LTBR Antibody. The picture on the right is treated with the synthesized peptide.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ELISA, ICC/IF

NB110-89474
Western Blot: CD11b Antibody [NB110-89474] - Detection of CD11b in RAW 264.7 whole cell lysates using NB110-89474.Immunocytochemistry/Immunofluorescence: CD11b Antibody [NB110-89474] - Staining of mouse pancreas using CD11b antibody at 1:400 dilution. Nuclei counterstained with DAPI (blue). Image provided by product review by verified customer.Immunohistochemistry: CD11b Antibody [NB110-89474] - Analysis of CD11b in human renal cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, FLOW, ICC/IF...MORE

     1 Review

14 Publications
NBP1-51967
Western Blot: CD11a Antibody [NBP1-51967] - NBP1-51967 (0.5ug/ml) staining of Human Spleen lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.Immunohistochemistry-Paraffin: CD11a Antibody [NBP1-51967] - NBP1-51967 (3.8ug/ml) staining of paraffin embedded Human Spleen. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.

Goat Polyclonal
Species Human
Applications WB, IHC, IHC-P...MORE

NB110-57141
Western Blot: CD11c Antibody (EP1347Y) [NB110-57141] - THP-1+TPA lysate.Immunohistochemistry-Paraffin: CD11c Antibody (EP1347Y) [NB110-57141] - Positive staining in Normal spleen tissue.Immunohistochemistry: CD11c Antibody (EP1347Y) [NB110-57141] - Immunohistochemical staining of paraffin-embedded human lymph node.

Rabbit Monoclonal
Species Human, Mouse (Negative), Rat (Negative)
Applications WB, ICC/IF, IHC...MORE

1 Publication
NBP1-51148

Mouse Monoclonal
Species Mouse, Rat
Applications FLOW, IA, IHC...MORE

5 Publications
NBP1-61565
Western Blot: ICAM3 Antibody [NBP1-61565] - Analysis of extracts from NIH-3T3 cells, treated with TNF-a 20ng/ml 5', using ICAM3  Antibody. The lane on the right is treated with the synthesized peptide.Immunocytochemistry/Immunofluorescence: ICAM3 Antibody [NBP1-61565] - Analysis of A549 cells, using ICAM3  Antibody. The picture on the right is treated with the synthesized peptide.

Rabbit Polyclonal
Species Human
Applications WB, ELISA, ICC/IF

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
NB100-65423
Flow Cytometry: HLA DQ/DR Antibody (49.1) [NB100-65423] - Staining of sheep peripheral blood lymphocytes with MOUSE ANTI OVINE MHC CLASS II DQ/DR (POLYMORPHIC).

Mouse Monoclonal
Species Human, Bovine, Goat...MORE
Applications FLOW, IHC, IHC-Fr...MORE

NBP2-31143
Western Blot: CTLA4 Antibody (37B3D8.2F2) [NBP2-31143] - WB analysis of CTLA-4 protein on (A) mouse Kidney lysate (B) human Kidney lysate and on © partial recombinant protein using CTLA-4 monoclonal antibody at a concentration of 2 ug/ml.

Mouse Monoclonal
Species Human, Mouse
Applications WB

NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications FLOW, Func

1 Publication
NB110-55702
Western Blot: CD45 Antibody (EP322Y) [NB110-55702] - Jurkat.Immunohistochemistry-Paraffin: CD45 Antibody (EP322Y) [NB110-55702] - Normal spleen tissue.Flow Cytometry: CD45 Antibody (EP322Y) [NB110-55702] - Flow cytometric analysis of permeabilized Jurkat cells using anti-CD45 (red) and a rabbit IgG (negative) (green).

Rabbit Monoclonal
Species Human, Mouse (Negative), Rat (Negative)
Applications WB, FLOW, IHC...MORE

NBP1-19532
Immunocytochemistry/Immunofluorescence: TNF alpha Antibody [NBP1-19532] - TNF alpha antibody was tested in A431 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Immunohistochemistry-Paraffin: TNF alpha Antibody [NBP1-19532] - Immunohistochemical staining of TNF alpha in mouse intestine.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

     1 Review

4 Publications
NBP1-88968
Western Blot: NDUFA2 Antibody [NBP1-88968] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG spImmunohistochemistry-Paraffin: NDUFA2 Antibody [NBP1-88968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

NBP2-25194
Flow Cytometry: CD14 Antibody (RPA-M1) [NBP2-25194] - Cell surface analysis of CD14 in 10^6 human monocytes using 0.1 ug of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD14 antibody. cell surface flow kit and anti-mouse IgG-FITC secondary was used for this test.

Mouse Monoclonal
Species Human
Applications FLOW

NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - Dog spleen homogenate. Probed with anti-CD4 and anti-CD8. Image from verified customer review.Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Staining of paraffin-embedded mouse brain tissue. Photo courtesy of product review by verified customer.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, FLOW, ICC/IF...MORE

     7 Reviews

5 Publications
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.

Mouse Monoclonal
Species Human
Applications WB, FLOW, IHC...MORE

NBP1-19793
Western Blot: CD13 Antibody [NBP1-19793] - Lane1:Mouse liver tissue lysate. Lane2:Rat liver tissue lysate.Immunohistochemistry-Paraffin: CD13 Antibody [NBP1-19793] - Paraffin-embedded human brain tissue.Western Blot: CD13 Antibody [NBP1-19793] - (WB) analysis of CD13 (Q917) antibody in extracts from mouse liver cells.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, IHC, IHC-P

NBP1-58001
Western Blot: Pregnancy Specific Glycoprotein 1 Antibody [NBP1-58001] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.Immunohistochemistry-Paraffin: Pregnancy Specific Glycoprotein 1 Antibody [NBP1-58001] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

Bioinformatics Tool for Integrin alpha D/CD11d

Discover related pathways, diseases and genes to Integrin alpha D/CD11d. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Research Areas for Integrin alpha D/CD11d

Find related products by research area.

PTMs for Integrin alpha D/CD11d

Learn more about PTMs related to Integrin alpha D/CD11d.

Blogs on Integrin alpha D/CD11d

There are no specific blogs for Integrin alpha D/CD11d, but you can read our latest blog posts.