Integrin alpha D/CD11d Antibody 0.1 ml

Click image to view larger
Immunohistochemistry: Integrin alpha D/CD11d Antibody [NBP1-90237] - Staining of human bone marrow shows distinct cytoplasmic positivity in a subset of bone marrow poietic cells.
Download Datasheet
See All Related

Ordering Information: NBP1-90237

  • Catalog Number
    NBP1-90237
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

Integrin alpha D/CD11d Antibody Summary

Species Human
Tested Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAD
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Integrin alpha D/CD11d Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLV

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Positive Controls
Control Peptide
Integrin alpha D/CD11d Protein (NBP1-90237PEP)

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for Integrin alpha D/CD11d Antibody (NBP1-90237). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using Integrin alpha D/CD11d Antibody (NBP1-90237).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol ITGAD
Entrez
Uniprot

Alternate Names for Integrin alpha D/CD11d Antibody

  • ADB2
  • CD11 antigen-like family member D
  • CD11d
  • FLJ39841
  • integrin alpha-D
  • integrin, alpha D
  • Leukointegrin Alpha D
Show More

Related Products by Gene


Reviews for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no reviews for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Integrin alpha D/CD11d Antibody (NBP1-90237)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no publications for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Integrin alpha D/CD11d Antibody (NBP1-90237)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Integrin alpha D/CD11d (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

NB200-610
Immunocytochemistry/Immunofluorescence: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - A-D Confocal microscopy of IBA-1 (green staining) immunohistochemistry of RPE flatmounts (RPE autofluorescence visible as orange due to its autofluorescence in the red and green channel) from a healthy donor (A), a geographic atrophy lesion (B), and large drusen (C and D). (A, B, D): orthogonal Z-stack projection; (C): oblique Z-stack projection and dissecting microscope appearance of postmortem large drusen after removal of the overlaying retina (inset). E-G Double-labeling on the subretinal side of the retina (to avoid masking by RPE autofluorescence) of IBA-1+ (E, green fluorescence) and CD18 (F, red fluorescence; G, merge). H. Orthogonal and lateral Z-stack of a subretinal IBA-1+ (green fluorescence) MPs adjacent to the RPE (orange autofluorescence) in the vicinity of a large drusen.Flow Cytometry: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - Staining of human peripheral blood granulocytes with RAT ANTI HUMAN CD18: FITC.Immunocytochemistry/Immunofluorescence: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - Analysis of canine thoracic fluid samples using anti-Integrin beta 2 antibody. The antibody showing positive cell surface staining. Image from verified customer review.

Rat Monoclonal
Species Human, Canine, Guinea Pig
Applications Flow, ICC/IF, IHC...MORE

     1 Review

AF1008

Goat Polyclonal
Species Mouse
Applications WB, Flow, IHC

5 Publications
NB110-89474
Western Blot: Integrin alpha M/CD11b Antibody [NB110-89474] - Detection of CD11b in RAW 264.7 whole cell lysates using NB110-89474.Immunocytochemistry/Immunofluorescence: Integrin alpha M/CD11b Antibody [NB110-89474] - Staining of mouse pancreas using CD11b antibody at 1:400 dilution. Nuclei counterstained with DAPI (blue). Image provided by product review by verified customer.Immunohistochemistry: Integrin alpha M/CD11b Antibody [NB110-89474] - Analysis of CD11b in human renal cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, Simple Western, Flow...MORE

     2 Reviews

24 Publications
MAB3595
Western blot shows lysates of human peripheral blood mononuclear cells (PBMC). PVDF Membrane was probed with 1 µg/mL of Human Integrin  alpha L/CD11a Monoclonal Antibody (Catalog # MAB3595) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Integrin  alpha L/CD11a at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Mouse Monoclonal
Species Human
Applications WB, Flow

     1 Review

2 Publications
NB110-97871
Immunohistochemistry: CD11c Antibody (AP-MAB0806) [NB110-97871] - Negative controlImmunohistochemistry-Paraffin: CD11c Antibody (AP-MAB0806) [NB110-97871] - Paraffin embedded mouse spleen tissue.

Armenian Hamster Monoclonal
Species Mouse
Applications Flow, IHC, IHC-P...MORE

3 Publications
NBP2-46010
Western Blot: ICAM-3/CD50 Antibody (1E7) [NBP2-46010] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ICAM-3.Immunohistochemistry: ICAM-3/CD50 Antibody (1E7) [NBP2-46010] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)Western Blot: ICAM-3/CD50 Antibody (1E7) [NBP2-46010] - Analysis of extracts (35ug) from 9 different cell lines by using ICAM3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).

Mouse monoclonal
Species Human, Canine, Monkey
Applications WB, IHC, IF

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Western Blot Image of anti-NOD2 (2D9) Whole cell protein from THP-1 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-NOD2 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [KDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.Immunocytochemistry/Immunofluorescence: HLA DQA1 Antibody [NBP1-84550] - Staining of human cell line U-251MG shows positivity in cytoplasm.Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Analysis of CD3+ hPMBCs using the APC conjugate of this antibody. A cell surface stain was performed on CD3+ hPBMCs with V alpha 24 J alpha 18 TCR antibody (6B11) NBP2-00267PE (top image) and a matched isotype control NBP2-27287 (bottom image). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. A co-stain was also performed using CD3 antibody NBP2-24867APC.Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications Flow, Func, In vitro...MORE

6 Publications
NB100-77417
Immunocytochemistry/Immunofluorescence: CD45 Antibody (30-F11) [NB100-77417] - IF on mouse liver. Image from verified customer review.Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - IHC analysis of formalin fixed and paraffin embedded section of mouse spleen using rat monoclonal CD45 antibody (clone 30-F11) at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section. Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse  (Balb C) splenocytes (1x10^6) were stained with CD45 antibody (NB100-77417) at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).

Rat Monoclonal
Species Mouse
Applications WB, Flow, Func...MORE

     3 Reviews

13 Publications
NBP1-88968
Western Blot: NDUFA2 Antibody [NBP1-88968] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spImmunohistochemistry-Paraffin: NDUFA2 Antibody [NBP1-88968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse spleen using CD4 antibody at 1:300 dilution with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a strong signal in the membranes of a subset of cells in the spleen section and the staining showed punctate appearance in some cells.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ICC/IF...MORE

     5 Reviews

7 Publications
NB100-64843
Immunohistochemistry-Paraffin: Aminopeptidase N/CD13 Antibody (ER-BMDM1) [NB100-64843] - Staining of a mouse tail cryosection with Rat anti Mouse CD13 antibody.Flow Cytometry: Aminopeptidase N/CD13 Antibody (ER-BMDM1) [NB100-64843] - Staining of mouse peripheral blood granulocytes with Rat anti Mouse CD13 (NB100-64843).Immunohistochemistry-Frozen: Aminopeptidase N/CD13 Antibody (ER-BMDM1) [NB100-64843] - Mouse lymph node cryosection with Rat anti Mouse CD13 antibody,

Rat Monoclonal
Species Mouse
Applications Flow, IHC, IHC-Fr

MAB6799
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PSG‑1 Monoclonal Antibody (Catalog # MAB6799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PSG‑1 at approximately 72 and 64 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.PSG‑1 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human PSG‑1 Mono­clonal Antibody (Catalog # MAB6799) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytotrophoblast cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Mouse Monoclonal
Species Human
Applications WB, IHC

Bioinformatics Tool for Integrin alpha D/CD11d

Discover related pathways, diseases and genes to Integrin alpha D/CD11d. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool
Vizit™, under license from BioVista Inc.

Research Areas for Integrin alpha D/CD11d

Find related products by research area.

PTMs for Integrin alpha D/CD11d

Learn more about PTMs related to Integrin alpha D/CD11d.

Blogs on Integrin alpha D/CD11d

There are no specific blogs for Integrin alpha D/CD11d, but you can read our latest blog posts.