Integrin alpha D/CD11d Antibody 0.1 ml

Click image to view larger
Immunohistochemistry: Integrin alpha D/CD11d Antibody [NBP1-90237] - Staining of human bone marrow shows distinct cytoplasmic positivity in a subset of bone marrow poietic cells.
Download Datasheet
See All Related

Ordering Information: NBP1-90237

  • Catalog Number
    NBP1-90237
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

Integrin alpha D/CD11d Antibody Summary

Species Human
Tested Applications IHC
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAD
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Integrin alpha D/CD11d Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCVEDVVSPIILHLNFSLV

Species Reactivity

Expected identity based on immunogen sequence: Mouse (76%), Rat (77%).

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Positive Controls

Contact Information

Product PDFs

Reviews

Earn rewards points by submitting your review for Integrin alpha D/CD11d Antibody (NBP1-90237). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using Integrin alpha D/CD11d Antibody (NBP1-90237).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol ITGAD
Entrez
Uniprot

Alternate Names for Integrin alpha D/CD11d Antibody

  • ADB2
  • CD11d
  • Leukointegrin Alpha D
  • ADB2
  • CD11 antigen-like family member D
  • CD11D
  • FLJ39841
  • integrin alpha-D
  • integrin, alpha D
  • leukointegrin alpha D
Show More

Related Products by Gene


Reviews for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no reviews for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Integrin alpha D/CD11d Antibody (NBP1-90237)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Integrin alpha D/CD11d Antibody (NBP1-90237) (0)

There are no publications for Integrin alpha D/CD11d Antibody (NBP1-90237).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Integrin alpha D/CD11d Antibody (NBP1-90237)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Integrin alpha D/CD11d (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NB200-610
Immunocytochemistry/Immunofluorescence: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - A-D Confocal microscopy of IBA-1 (green staining) immunohistochemistry of RPE flatmounts (RPE autofluorescence visible as orange due to its autofluorescence in the red and green channel) from a healthy donor (A), a geographic atrophy lesion (B), and large drusen (C and D). (A, B, D): orthogonal Z-stack projection; (C): oblique Z-stack projection and dissecting microscope appearance of postmortem large drusen after removal of the overlaying retina (inset). E-G Double-labeling on the subretinal side of the retina (to avoid masking by RPE autofluorescence) of IBA-1+ (E, green fluorescence) and CD18 (F, red fluorescence; G, merge). H. Orthogonal and lateral Z-stack of a subretinal IBA-1+ (green fluorescence) MPs adjacent to the RPE (orange autofluorescence) in the vicinity of a large drusen.Flow Cytometry: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - LFA-1 activation analyses by Flow Cytometry. (A) Profiles of CD11a, CD18 activation epitope (CD18act, representing high affinity conformation) and CD18 (CD18tot) expression by Teff and Treg#1 cells pre-incubated or not with indicated antibodies. Anti-CD28 and anti-CTLA-4 were used at 10 ug/ml. (B) Histograms of Mean Fluorescent Intensity (MFI) of CD11a, CD18act and CD18tot expressed on Teff and Treg#1 cells. Ratio CD18act MFI: CD18tot was established to analyze LFA-1 high affinity conformation in indicated conditions. Data are representative of more than three different experiments. Filled gray, negative control; Red line, Teff and Treg cells alone; Green line, cells with APC; Blue line, cells with APC and anti-CD28; and Black line: cells with APC, anti-CD28 and anti-CTLA-4.Immunocytochemistry/Immunofluorescence: Integrin beta 2/CD18 Antibody (YFC118.3) [NB200-610] - Analysis of canine thoracic fluid samples using anti-Integrin beta 2 antibody. The antibody showing positive cell surface staining. Image from verified customer review.

Rat Monoclonal
Species Human, Canine, Guinea Pig
Applications Flow, ICC/IF, IHC...MORE

     1 Review




NB110-89474
Western Blot: CD11b Antibody [NB110-89474] - Detection of CD11b in RAW 264.7 whole cell lysates using NB110-89474.Immunocytochemistry/Immunofluorescence: CD11b Antibody [NB110-89474] - Staining of mouse pancreas using CD11b antibody at 1:400 dilution. Nuclei counterstained with DAPI (blue). Image provided by product review by verified customer.Immunohistochemistry: CD11b Antibody [NB110-89474] - Analysis of CD11b in human renal cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, Simple Western, Flow...MORE

     2 Reviews

16 Publications
MAB3595
Western blot shows lysates of human peripheral blood mononuclear cells (PBMC). PVDF Membrane was probed with 1 µg/mL of Human Integrin aL/CD11a Monoclonal Antibody (Catalog # MAB3595) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # <a class=

Mouse Monoclonal
Species Human
Applications WB, Flow

     1 Review

2 Publications
NB110-57141
Western Blot: CD11c Antibody (EP1347Y) [NB110-57141] - THP-1+TPA lysate.Immunohistochemistry: CD11c Antibody (EP1347Y) [NB110-57141] - Immunohistochemical staining of paraffin-embedded human lymph node.Immunohistochemistry-Paraffin: CD11c Antibody (EP1347Y) [NB110-57141] - Staining CD11c in human tonsil tissue.

Rabbit Monoclonal
Species Human, Mouse (Negative), Rat (Negative)
Applications WB, ICC/IF, IHC...MORE

2 Publications
AF3667
Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # <A class=NoLineLink href=Myeloperoxidase/MPO was detected in immersion fixed paraffin-embedded sections of human spleen using 3 µg/mL Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # <A class=Simple Western lane view shows lysates of mouse spleen tissue, loaded at 0.2 mg/mL. A specific band was detected for Myeloperoxidase/MPO at approximately 67 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # <A class=NoLineLink href=

Goat Polyclonal
Species Human, Mouse
Applications WB, Simple Western, IHC...MORE

2 Publications



NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
NB100-2700

Mouse Monoclonal
Species Human
Applications WB, ELISA, Flow...MORE

NB100-64849

Mouse Monoclonal
Species Human
Applications Flow, IHC, IHC-Fr...MORE

NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications Flow, Func, In vivo

2 Publications
NB100-77417
Immunocytochemistry/Immunofluorescence: CD45 Antibody (30-F11) [NB100-77417] - IF on mouse liver. Image from verified customer review.Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - IHC analysis of formalin fixed and paraffin embedded section of mouse spleen using rat monoclonal CD45 antibody (clone 30-F11) at 1:50 dilution. The antibody generated an expected membrane staining in the red and white pulp spleenocytes of the tested spleen section. Flow Cytometry: CD45 Antibody (30-F11) [NB100-77417] - Analysis of CD45 (30F11) in freshly isolated mouse  (Balb C) splenocytes (1x10^6) were stained with CD45 antibody (NB100-77417) at 1:1000 dilution and detected with FITC conjugated donkey anti-rat IgG secondary (orange). Shown with rat IgG isotype control (blue).

Rat Monoclonal
Species Mouse
Applications WB, Flow, ICC/IF...MORE

     2 Reviews

12 Publications



NBP1-88968
Western Blot: NDUFA2 Antibody [NBP1-88968] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG spImmunohistochemistry-Paraffin: NDUFA2 Antibody [NBP1-88968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

NBP2-25194
Flow Cytometry: CD14 Antibody (RPA-M1) [NBP2-25194] - Cell surface analysis of CD14 in 10^6 human monocytes using 0.1 ug of this antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents anti-CD14 antibody. cell surface flow kit and anti-mouse IgG-FITC secondary was used for this test.

Mouse Monoclonal
Species Human
Applications Flow

NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - Dog spleen homogenate. Probed with anti-CD4 and anti-CD8. Image from verified customer review.Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Staining of paraffin-embedded mouse brain tissue. Photo courtesy of product review by verified customer.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, Flow...MORE

     7 Reviews

6 Publications
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.

Mouse Monoclonal
Species Human
Applications WB, Flow, IHC...MORE




MAB6799
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PSG-1 Monoclonal Antibody (Catalog # MAB6799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # <A class=NoLineLink href=PSG-1 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human PSG-1 Mono­clonal Antibody (Catalog # MAB6799) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # <A class=NoLineLink href=

Mouse Monoclonal
Species Human
Applications WB, IHC

Additional Products by Application

Additional Integrin alpha D/CD11d Antibody Products

Bioinformatics Tool for Integrin alpha D/CD11d

Discover related pathways, diseases and genes to Integrin alpha D/CD11d. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Research Areas for Integrin alpha D/CD11d

Find related products by research area.

PTMs for Integrin alpha D/CD11d

Learn more about PTMs related to Integrin alpha D/CD11d.

Blogs on Integrin alpha D/CD11d

There are no specific blogs for Integrin alpha D/CD11d, but you can read our latest blog posts.