IQGAP1 Antibody (H00008826-A01)
IQGAP1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HUMORFA01 antibody, anti-SAR1 antibody, anti-p195 antibody, anti-KIAA0051 antibody, |
|
|
IQGAP1 Antibody Summary: | | Gene: | IQGAP1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | IQGAP1 - IQ motif containing GTPase activating protein 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IQGAP1 Products IQGAP1 Antibody Details: | Immunogen: | IQGAP1 (NP_003861, 611 a.a. ~ 711 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | WQSNKDTQEAQKFALGIFAINEAVESGDVG KTLSALRSPDVGLYGVIPECGETYHSDLAE AKKKKLAVGDNNSKWVKHWVKGGYYYYHNL ETQEGGWDEP* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.
|
Reviews (0) Related Products (11) Exploring IQGAP1
|
Jump to: Ask a Question
|
Working with IQGAP1
IQGAP1 Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about IQGAP1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (9)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| IQGAP1 Antibody | NBP1-06529 | Hu | IF, IHC-P, IP, WB | (2) | | | | | IQGAP1 Antibody (2C5) | H00008826-M01 | Hu | ELISA, IF, IHC-P, WB | (4) | (1) | | | | IQGAP1 Antibody | NBP1-83143 | Hu | IF, IHC-P, WB | (3) | | | | | IQGAP1 Antibody (EPR5220) | NBP1-95698 | Hu, Mu | ICC, IHC-P, WB | (2) | | | | | IQGAP1 Antibody (EPR5221) | NBP1-95629 | Hu | ICC, IHC-P, WB | (2) | | | | | ... and 4 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
