IQGAP1 Antibody (H00008826-M01)
IQGAP1 Antibody (2C5)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HUMORFA01 antibody, anti-SAR1 antibody, anti-p195 antibody, anti-KIAA0051 antibody |
|
|
IQGAP1 Antibody (2C5) Summary: | | Gene: | IQGAP1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | IQGAP1 - IQ motif containing GTPase activating protein 1 |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IQGAP1 Products IQGAP1 Antibody (2C5) Details: | Clone: | 2C5 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | IQGAP1 (NP_003861, 611 a.a. ~ 711 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | WQSNKDTQEAQKFALGIFAINEAVESGDVG KTLSALRSPDVGLYGVIPECGETYHSDLAE AKKKKLAVGDNNSKWVKHWVKGGYYYYHNL ETQEGGWDEP* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.
|
Images (4) Reviews (0) Related Products (11) Exploring IQGAP1 Working with IQGAP1
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| IQGAP1 Antibody | NBP1-06529 | Hu | IF, IHC-P, IP, WB | (2) | | | | | IQGAP1 Antibody | NBP1-83143 | Hu | IF, IHC-P, WB | (3) | | | | | IQGAP1 Antibody (EPR5220) | NBP1-95698 | Hu, Mu | ICC, IHC-P, WB | (2) | | | | | IQGAP1 Antibody (EPR5221) | NBP1-95629 | Hu | ICC, IHC-P, WB | (2) | | | | | IQGAP1 Antibody | NBP1-51980 | Hu, Mu, Rt | PEP-ELISA, WB | | | | | | ... and 3 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to IQGAP1 ( Cat # H00008826-M01 ) on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]](http://images.novusbio.com/images/H00008826-M01-3-6-1-S.jpg "Immunoperoxidase of monoclonal antibody to IQGAP1 ( Cat # H00008826-M01 ) on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]")
![Immunofluorescence of monoclonal antibody to IQGAP1 (H00008826-M01) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00008826-M01-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to IQGAP1 (H00008826-M01) on HeLa cell . [antibody concentration 10 ug/ml]")
