We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

IL-6 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related IL-6 Primary Antibodies

Order Details


    • Catalog Number
      H00003569-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

IL-6 Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
IL6 (AAH15511, 1 a.a. - 212 a.a.) full-length human protein. MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Specificity
IL6 - interleukin 6 (interferon, beta 2),
Clonality
Polyclonal
Host
Mouse
Gene
IL6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. May also be used for IF, IHC-P.
Publications
Read Publication using H00003569-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-6 Antibody

  • B-cell differentiation factor
  • B-cell stimulatory factor 2
  • BSF2
  • BSF-2
  • CDF
  • CTL differentiation factor
  • HSF
  • hybridoma growth factor
  • IFNB2
  • IFN-beta-2
  • IL6
  • IL-6
  • Interferon beta-2
  • interleukin 6 (interferon, beta 2)
  • interleukin BSF-2
  • interleukin-6
  • MGI-2A

Background

IL6 is an immunoregulatory cytokine that activates a cell surface signaling assembly composed of IL6, IL6RA (IL6R; MIM 147880), and the shared signaling receptor gp130 (IL6ST; MIM 600694) (Boulanger et al., 2003 [PubMed 12829785]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY417
Species: Mu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
201-LB
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
485-MI
Species: Mu
Applications: BA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
DCP00
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
7734-LF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
203-IL
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB

Publications for IL-6 Antibody (H00003569-B01P)(1)

Reviews for IL-6 Antibody (H00003569-B01P) (0)

There are no reviews for IL-6 Antibody (H00003569-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IL-6 Antibody (H00003569-B01P). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you know of any blocking antibodies against IL-6 or VEGF-C that can be used in cell culture to quench these cytokines?
    • We have no antibodies that are currently known to show blocking antibodies to VEGF-C. Please see this link to our IL-6 antibodies with blocking/neutralizing activity can be found at this link.

Secondary Antibodies

 

Isotype Controls

Additional IL-6 Products

Research Areas for IL-6 Antibody (H00003569-B01P)

Find related products by research area.

Blogs on IL-6. Showing 1-10 of 12 blog posts - Show all blog posts.


  Read full blog post.


  Read full blog post.

Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender?
By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm...  Read full blog post.


  Read full blog post.

Metabolic Syndrome: Symptoms and associated disease states
By Jamshed Arslan, Pharm. D., PhD. What is metabolic syndrome?It was 1988 when, after decades of research, Dr. GM Reaven    of the Stanford University, CA, explained the relationship between four diseases:...  Read full blog post.

Increased wild type FUS levels in ALS patients lead to a toxic microenvironment and motor neuron neurodegeneration
By Michalina Hanzel, PhDFUS mutations in Amyotrophic Lateral SclerosisFused in sarcoma (FUS) is a ribonucleoprotein that continuously shuttles between the nucleus and the cytoplasm to regulate pre-mRNA splicing, mRN...  Read full blog post.

The role of HIF-2 alpha in the progression and therapy of clear cell renal cell carcinoma
HIF-2 alpha, also known as hypoxia-inducible factor 2, endothelial PAS domain protein-1, and member of PAS superfamily 2 is part of the HIF family of proteins.  The HIF family is composed of HIF-1, HIF-2 and HIF-3, where HIF-2 is a dimeric protein ...  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

VEGF: Vascular endothelial growth factor
VEGF is homodimeric, disulfide-linked glycoprotein cytokine that serves as the ligand for FLT1 (VEGFR-1 receptor) and FLK1 (VEGFR-2 receptor) tyrosine kinases. It is a key modulator of physiological angiogenesis, vasculogenesis, and endothelial cell g...  Read full blog post.

TLR2 - I can recognize many foreign pathogens!
TLR2 is a member of the broad family of Toll-like receptors (TLR) that play an important role in pathogen recognition and innate immunity. TLRs, like other pattern recognition receptors (PRRs), recognize endogenous ligands released during cell or tiss...  Read full blog post.

Showing 1-10 of 12 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6
Entrez
Uniprot