| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IL6 (AAH15511, 1 a.a. - 212 a.a.) full-length human protein. MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Specificity | IL6 - interleukin 6 (interferon, beta 2), |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | IL6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. May also be used for IF, IHC-P. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00003569-B01P | Applications | Species |
|---|---|---|
| Eiro N, Gonzalez L, Martinez-Ordonez A et al. Cancer-associated fibroblasts affect breast cancer cell gene expression, invasion and angiogenesis. Cell Oncol (Dordr) 2018-03-01 [PMID: 29497991] |
Secondary Antibodies |
Isotype Controls |
Research Areas for IL-6 Antibody (H00003569-B01P)Find related products by research area.
|
|
Read full blog post. |
|
Read full blog post. |
|
Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender? By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm... Read full blog post. |
|
Read full blog post. |
|
Metabolic Syndrome: Symptoms and associated disease states By Jamshed Arslan, Pharm. D., PhD. What is metabolic syndrome?It was 1988 when, after decades of research, Dr. GM Reaven of the Stanford University, CA, explained the relationship between four diseases:... Read full blog post. |
|
Increased wild type FUS levels in ALS patients lead to a toxic microenvironment and motor neuron neurodegeneration By Michalina Hanzel, PhDFUS mutations in Amyotrophic Lateral SclerosisFused in sarcoma (FUS) is a ribonucleoprotein that continuously shuttles between the nucleus and the cytoplasm to regulate pre-mRNA splicing, mRN... Read full blog post. |
|
The role of HIF-2 alpha in the progression and therapy of clear cell renal cell carcinoma HIF-2 alpha, also known as hypoxia-inducible factor 2, endothelial PAS domain protein-1, and member of PAS superfamily 2 is part of the HIF family of proteins. The HIF family is composed of HIF-1, HIF-2 and HIF-3, where HIF-2 is a dimeric protein ... Read full blog post. |
|
The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura. It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol... Read full blog post. |
|
VEGF: Vascular endothelial growth factor VEGF is homodimeric, disulfide-linked glycoprotein cytokine that serves as the ligand for FLT1 (VEGFR-1 receptor) and FLK1 (VEGFR-2 receptor) tyrosine kinases. It is a key modulator of physiological angiogenesis, vasculogenesis, and endothelial cell g... Read full blog post. |
|
TLR2 - I can recognize many foreign pathogens! TLR2 is a member of the broad family of Toll-like receptors (TLR) that play an important role in pathogen recognition and innate immunity. TLRs, like other pattern recognition receptors (PRRs), recognize endogenous ligands released during cell or tiss... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.