IGFBP1 Antibody (H00003484-A01)

IGFBP1 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
IGFBP1 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:IGFBP1
Purity:Whole antisera
Host:Mouse
Specificity:IGFBP1 - insulin-like growth factor binding protein 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional IGFBP1 Products
IGFBP1 Antibody Details:
Immunogen:IGFBP1 (NP_000587, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Epitope:GSKALHVTNIKKWKEPCRIELYRVVESLAK AQETSGEEISKFYLPNCNKNGFYHSRQCET SMDGEAGLCWCVYPWNGKRIPGSPEIRGDP NCQIYFNVQN*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: IGFBP1
Entrez3484 (Human)
OMIM146730 (Human)
Swiss ProtNP_000587 (Human)
 
Background:

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.

Jump to: Ask a Question

Working with IGFBP1

IGFBP1 Antibody Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about IGFBP1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
IGFBP1 LysateNBL1-11873WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
IGFBP1 Partial Recombinant ProteinH00003484-Q01HuELISA, WB(1)

IGFBP1 Recombinant ProteinH00003484-P01HuELISA, WB(1)

IGFBP1 ProteinP4127HuFunc, PAGE

Primary Antibodies (11)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
IGFBP1 Antibody (G2)NB110-68180HuELISA, WB

IGFBP1 Antibody (A8)NB110-68179HuELISA, WB

IGFBP1 Antibody (RM0094-12D24)NBP1-22449MuWB

IGFBP1 Antibody (33627.11)NB120-10732HuELISA, WB(3)

IGFBP1 Antibody (7B11)NB110-9803HuELISA, IRMA

... and 6 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
IGFBP1 RNAiH00003484-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

IGFBP1 in Context


Novus Explorer for IGFBP1 gene

Try our bioinformatic tool that shows the relationships between IGFBP1 and other genes, diseases, pathways and post-translational modifications.