IGFBP1 Antibody (H00003484-M01)
IGFBP1 Antibody (2F9)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-AFBP antibody, anti-PP12 antibody, anti-IGF-BP25 antibody, anti-IBP1 antibody, anti-hIGFBP-1 antibody, |
|
|
IGFBP1 Antibody (2F9) Summary: | | Gene: | IGFBP1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IGFBP1 Products IGFBP1 Antibody (2F9) Details: | Clone: | 2F9 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | IGFBP1 (NP_000587, 160 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | GSKALHVTNIKKWKEPCRIELYRVVESLAK AQETSGEEISKFYLPNCNKNGFYHSRQCET SMDGEAGLCWCVYPWNGKRIPGSPEIRGDP NCQIYFNVQN* |
|---|
Human. Other species not tested. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
|
Reviews (0) Related Products (18)
|
Jump to: Ask a Question
|
Working with IGFBP1
IGFBP1 Antibody (2F9) Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about IGFBP1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (9)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| IGFBP1 in Context
|
Novus Explorer for IGFBP1 gene
|
|
