IGF2BP2 Antibody (H00010644-B01P)
IGF2BP2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-IMP2 antibody, anti-VICKZ2 antibody, anti-p62 antibody, |
|
|
IGF2BP2 Antibody Summary: | | Gene: | IGF2BP2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | IMP-2 - IGF-II mRNA-binding protein 2, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IGF2BP2 Products IGF2BP2 Antibody Details: | Immunogen: | IMP-2 (AAH21290.1, 1 a.a. ~ 598 a.a) full-length human protein. |
|---|
| Epitope: | MNKLYIGNLSPAVTADDLRQLFGDRKLPLA GQVLLKSGYAFVDYPDQNWAIRAIETLSGK VELHGKIMEVDYSVSKKLRSRKIQIRNIPP HLQWEVLDGLLAQYGTVENVEQVNTDTETA VVNVTYATREEAKIAMEKLSGHQFENYSFK ISYIPDEEVSSPSPPQRAQRGDHSSREQGH APGGTSQARQIDFPLRILVPTQFVGAIIGK EGLTIKNITKQTQSRVDIHRKENSGAAEKP VTIHATPEGTSEACR |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500, |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains several four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
|
Images (3) Reviews (0) Related Products (20) Exploring IGF2BP2
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| IGF2BP2 Antibody | 23750002 | Hu | ELISA, IHC-P, WB | (3) | | | | | IGF2BP2 Antibody | NBP1-96713 | Hu, Mu, Rt | ICC, IHC-P, WB | (2) | | | | | IGF2BP2 Antibody | NB100-93408 | Ca, Hu, Mu | PEP-ELISA | (2) | (1) | | | | IGF2BP2 Antibody | NBP1-33728 | Hu | IF, WB | (2) | | | | | IGF2BP2 Antibody | H00010644-D01 | Hu | Func, IP, WB | | | | | | ... and 7 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of <u>purified</u> MaxPab antibody to IMP-2 on HeLa cell. [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00010644-B01P-4-1-1-S.jpg "Immunofluorescence of <u>purified</u> MaxPab antibody to IMP-2 on HeLa cell. [antibody concentration 10 ug/ml]")
