IGF2BP2 Antibody (H00010644-A01)
IGF2BP2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-IMP2 antibody, anti-VICKZ2 antibody, anti-p62 antibody, |
|
|
IGF2BP2 Antibody Summary: | | Gene: | IGF2BP2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | IMP-2 - IGF-II mRNA-binding protein 2 |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IGF2BP2 Products IGF2BP2 Antibody Details: | Immunogen: | IMP-2 (NP_006539, 65 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | HGKIMEVDYSVSKKLRSRKIQIRNIPPHLQ WEVLDGLLAQYGTVENVEQVNTDTETAVVN VTYATREEAKIAMEKLSGHQFENYSFKISY IPDEEVSSPSPPQRA* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains several four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
|
Reviews (0) Related Products (20) Exploring IGF2BP2 Working with IGF2BP2
|
Jump to: Publications, Ask a Question
|
Working with IGF2BP2
IGF2BP2 Antibody Images (0)
|
|
|
Publications (1)
|
|
|
Ask a Scientist
Can't find an answer to your question about IGF2BP2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (11)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| IGF2BP2 Antibody | 23750002 | Hu | ELISA, IHC-P, WB | (3) | | | | | IGF2BP2 Antibody | NBP1-96713 | Hu, Mu, Rt | ICC, IHC-P, WB | (2) | | | | | IGF2BP2 Antibody | NB100-93408 | Ca, Hu, Mu | PEP-ELISA | (2) | (1) | | | | IGF2BP2 Antibody | H00010644-B01P | Hu | ELISA, IF, WB | (3) | | | | | IGF2BP2 Antibody | NBP1-33728 | Hu | IF, WB | (2) | | | | | ... and 6 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
