Recombinant Human IGF-II/IGF2 Protein Summary
| Description |
IGF2 (Human) Recombinant Protein
Source: E. coli
Amino Acid Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Preparation Method |
Escherichia coli expression system |
| Details of Functionality |
The activity is determined by the dose-dependent induction of FDC-P1 cell proliferation. The expected ED50 for this effect is 1.1-1.6 ng/mL. |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
IGF2 |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is useful for Func,SDS-PAGE. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
No additive Reconstitute with sterilized water. |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human IGF-II/IGF2 Protein
Background
Insulin Like Growth Factor-2 (IGF-2) is a polypeptide growth factor, which stimulates the proliferation of a wide range of cell types
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for IGF-II/IGF2 Recombinant Protein (P4401) (0)
There are no publications for IGF-II/IGF2 Recombinant Protein (P4401).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGF-II/IGF2 Recombinant Protein (P4401) (0)
There are no reviews for IGF-II/IGF2 Recombinant Protein (P4401).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IGF-II/IGF2 Recombinant Protein (P4401) (0)
Additional IGF-II/IGF2 Products
Research Areas for IGF-II/IGF2 Recombinant Protein (P4401)
Find related products by research area.
|
Blogs on IGF-II/IGF2