IDH3A Antibody (H00003419-B01P)
IDH3A Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
IDH3A Antibody Summary: | | Gene: | IDH3A |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | IDH3A - isocitrate dehydrogenase 3 (NAD+) alpha, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional IDH3A Products IDH3A Antibody Details: | Immunogen: | IDH3A (NP_005521.1, 1 a.a. ~ 366 a.a) full-length human protein. |
|---|
| Epitope: | MAGPAWISKVSRLLGAFHNPKQVTRGFTGG VQTVTLIPGDGIGPEISAAVMKIFDAAKAP IQWEERNVTAIQGPGGKWMIPSEAKESMDK NKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTE GEYSGIEHVIVDGVVQSIKLITEGASKRIA EFAFEYARNNHRSNVTAVHKANIMRMSDGL FLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLY |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA,
immunofluorescence |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. [provided by RefSeq]
|
Images (4) Reviews (1) Related Products (10) Exploring IDH3A Working with IDH3A
|
Jump to: Images, Reviews, Ask a Question
|
Working with IDH3A
IDH3A Antibody Images (4) Western Blot analysis of IDH3A expression in transfected 293T cell line by IDH3A MaxPab polyclonal antibody.
Lane 1: IDH3A transfected lysate(40.26 KDa).
Lane 2: Non-transfected lysate.
|  Immunofluorescence of purified MaxPab antibody to IDH3A on HeLa cell. [antibody concentration 10 ug/ml] |  IDH3A MaxPab polyclonal antibody. Western Blot analysis of IDH3A expression in rat brain. |  IDH3A MaxPab polyclonal antibody. Western Blot analysis of IDH3A expression in A-431. |
|
Reviewed by:
Anonymous 8/4/2010
|
|
Application:
|
Western Blot
|
|
Sample Tested:
|
HCT116 whole cell lysate
|
|
Sample Loaded:
|
70ug
|
|
Species:
|
Human
|
|
Results:
|
Quite specific but not as sensitive.
|
|
Blocking Buffer:
|
5% Milk in TBST
|
|
Blocking Time:
|
1h
|
|
Blocking Temperature:
|
RT
|
|
Dilution Ratio:
|
1:500
|
|
Incubation Time:
|
overnight
|
|
Incubation Temperature:
|
4 Celsius
|
|
Incubation Dilution Buffer:
|
5% Milk in TBST
|
|
Description:
|
horse anti rabbit
|
|
Method:
|
ECL-plus
|
|
Exposure Time:
|
5min
|
|
Did you observe bands?:
|
Yes
|
|
Specific Bands:
|
~37 kDa
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about IDH3A? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (7)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
