Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
Synthetic peptide: MERPQLDSMSQDLSEALKEATKEVHIRAEN , corresponding to amino acids 1-30 of Rat Heme Oxygenase 1.
Localization:
Microsomal
Marker:
Endoplasmic Reticulum Marker
Species Reactivity:
Cross-reacts with Human, Rat, Cow and Primate.Not yet tested in other species.
Applications:
Uses:
Optimal dilution / concentration should be determined by the end user. By Western blot, this antibody detects a single 32 kDa protein representing HO1 from HeLa cells after stress induction. Immunohistochemical staining of HO1 in Alzheimer's diseased human brain results in staining of the neurofibrillary tangles, senile plaque neurites, and neuropil threads.
Dilutions:
Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin 1:100, Western Blot 1:1000
Unit Size:
0.1 ml
Concentration:
This product is unpurified. Concentration is not relevant.
Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:
PBS
Preservative:
0.05% Sodium Azide
Limitations:
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
HO1 expression is greatly increased in neurofibrillary tangles in Alzheimers disease and other neurodegenerative diseases such as progressive supranuclear palsy and subacute sclerosing panencephalitis.
Inhibition of HO1 is associated with tissue pathology in atherosclerosis and other inflammatory conditions associated with intravascular thrombosis such as septic shock, hypoxia, and graft rejection.