Heme Oxygenase 1 Antibody (H00003162-D01P)
Heme Oxygenase 1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HO-1 antibody, anti-HSP32 antibody, anti-bK286B10 antibody, |
|
|
Heme Oxygenase 1 Antibody Summary: | | Gene: | HMOX1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with heme oxygenase (decycling) 1. |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Heme Oxygenase 1 Products Heme Oxygenase 1 Antibody Details: | Immunogen: | HMOX1 (ENSP00000216117, 1 a.a. ~ 288 a.a) full-length human protein. |
|---|
| Marker: | Endoplasmic Reticulum Marker |
|---|
| Epitope: | MERPQPDSMPQDLSEALKEATKEVHTQAEN AEFMRNFQKGQVTRDGFKLVMASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALE QDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKI AQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLN IQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRG |
|---|
| Uses: | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (27) Exploring Heme Oxygenase 1
|
Jump to: Images, Ask a Question
|
Working with Heme Oxygenase 1
Heme Oxygenase 1 Antibody Images (2) Western Blot analysis of HMOX1 expression in transfected 293T cell line by HMOX1 MaxPab rabbit polyclonal antibody.
Lane 1: HMOX1 transfected lysate(32.80 KDa).
Lane 2: Non-transfected lysate.
|  HMOX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HMOX1 expression in human spleen. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Heme Oxygenase 1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (20)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Heme Oxygenase 1 Antibody | NBP1-77459 | Hu, Mu | ICC, IF, IHC-P | (2) | | | | | Heme Oxygenase 1 Antibody | NBP1-77460 | Hu, Mu | ICC, IF, IHC-P | (2) | | | | | Heme Oxygenase 1 Antibody (EP1391Y) | NB110-57028 | Hu, Mu, Rt(-) | ICC, IHC-P, IP, WB | (3) | (3) | | | | Heme Oxygenase 1 Antibody | NBP1-89964 | Hu | IF, IHC-P, WB | (2) | | | | | Heme Oxygenase 1 Antibody | NBP1-31341 | Hu | IF, IHC-P, WB | (3) | | | | | ... and 15 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Heme Oxygenase 1 in Context
Research Areas related to Heme Oxygenase 1 (1): |
|
Novus Explorer for Heme Oxygenase 1 gene
|
|
