Heme Oxygenase 1 Antibody (H00003162-M01)
Heme Oxygenase 1 Antibody (5C6)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HO-1 antibody, anti-bK286B10 antibody, |
|
|
Heme Oxygenase 1 Antibody (5C6) Summary: | | Gene: | HMOX1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | HMOX1 - heme oxygenase (decycling) 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Heme Oxygenase 1 Products Heme Oxygenase 1 Antibody (5C6) Details: | Clone: | 5C6 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | HMOX1 (NP_002124, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
|---|
| Marker: | Endoplasmic Reticulum Marker |
|---|
| Epitope: | MERPQPDSMPQDLSEALKEATKEVHTQAEN AEFMRNFQKGQVTRDGFKLVMASLYHIYVA LEEEIERNKESPVFAPVYFPEELHRKAALE QDLAFWYGPRWQEVIPYTPA* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.
|
Images (1) Reviews (0) Related Products (27) Exploring Heme Oxygenase 1
|
Jump to: Images, Ask a Question
|
Working with Heme Oxygenase 1
Heme Oxygenase 1 Antibody (5C6) Images (1) Detection limit for recombinant GST tagged HMOX1 is approximately 0.3ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Heme Oxygenase 1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (15)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Heme Oxygenase 1 Antibody | NBP1-77459 | Hu, Mu | ICC, IF, IHC-P | (2) | | | | | Heme Oxygenase 1 Antibody | NBP1-77460 | Hu, Mu | ICC, IF, IHC-P | (2) | | | | | Heme Oxygenase 1 Antibody (EP1391Y) | NB110-57028 | Hu, Mu, Rt(-) | ICC, IHC-P, IP, WB | (3) | (3) | | | | Heme Oxygenase 1 Antibody | NBP1-89964 | Hu | IF, IHC-P, WB | (2) | | | | | Heme Oxygenase 1 Antibody | NBP1-31341 | Hu | IF, IHC-P, WB | (3) | | | | | ... and 10 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Heme Oxygenase 1 in Context
Research Areas related to Heme Oxygenase 1 (1): |
|
Novus Explorer for Heme Oxygenase 1 gene
|
|
