HOMER2 Antibody (NBP1-85487) | Novus Biologicals

HOMER2 Antibody (NBP1-85487) (100 ul)

Additional Products Available View our HOMER2 products. Call 303-730-1950 for recommended products	Ordering Information:
	Catalog Number	NBP1-85487
	Size(s)	100 ul	Price:
	Availability
Why Choose Novus?	Bulk Quote
	View All HOMER2 Primary Antibodies

anti-HOMER-2A antibody, anti-Homer-2 antibody, anti-HOMER2B antibody, anti-homer, neuronal immediate early gene, 2 antibody, anti-HOMER2A antibody, anti-homer protein homolog 2 antibody, anti-Cupidin antibody, anti-homer homolog 3 antibody, anti-Vesl-2 antibody, anti-cupidin antibody, anti-HOMER-2 antibody, anti-ACPD antibody, anti-CPD antibody, anti-HOMER-2B antibody, anti-homer homolog 2 (Drosophila) antibody

HOMER2 Antibody Summary:

Species:	Hu	Gene:	HOMER2
Applications:	WB, IF, IHC-P	Purity:	Immunogen affinity purified
Clonality:	Polyclonal	Host:	Rabbit
Publications:

View Additional HOMER2 Products

Antibody Pairs	Lysates
Peptides and Proteins	Primary Antibodies
» View All HOMER2 Related Products

HOMER2 Antibody Details:

Isotype:	IgG
Immunogen:	The epitope recognized by this antibody maps to the antigen sequence: IIPQLMSECEYVSEKLEAAERDNQNLEDKV RSLKTDIEESKYRQRHLKVELKSFLEVLDG KIDDLHDFRRGLSKLGTDN

Species Reactivity:

Human

Applications:

Uses:	For ICH-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Dilutions:	Immunohistochemistry-Paraffin 1:200 - 1:500, Western Blot 1:250 - 1:500, Immunofluorescence 1 - 4 ug/ml
Unit Size:	100 ul
Concentration:	Please see the vial label for concentration.

Packaging:

Storage:	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer:	PBS, pH 7.2, containing 40% glycerol
Preservative:	0.02% Sodium Azide
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: HOMER2

Related Genes:

Images (3)



View All Images...

Be the first to review this product for a reward!

Review this product now.

HOMER2 Antibody Images (3)

	Western Blot: HOMER2 Antibody [NBP1-85487] Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 \| Lane 2: RT-4 \| Lane 3: U-251 MG \| Lane 4: Human Plasma \| Lane 5: Liver \| Lane 6: Tonsil

	Immunohistochemistry-Paraffin: HOMER2 Antibody [NBP1-85487] - Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.

	Immunofluorescence: HOMER2 Antibody [NBP1-85487] - 251 MG shows positivity in plasma membrane & cytoplasm.