HOMER2 Antibody (H00009455-D01P)

HOMER2 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
HOMER2 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:HOMER2
Purity:Protein A purified
Host:Rabbit
Specificity:Reacts with homer homolog 2 (Drosophila).
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional HOMER2 Products
HOMER2 Antibody Details:
Immunogen:HOMER2 (NP_004830.2, 1 a.a. ~ 343 a.a) full-length human protein.
Epitope:MGEQPIFTTRAHVFQIDPNTKKNWMPASKQ AVTVSYFYDVTRNSYRIISVDGAKVIINST ITPNMTFTKTSQKFGQWADSRANTVFGLGF SSEQQLTKFAEKFQEVKEAAKIAKDKTQEK IETSSNHSQASSVNGTDDEKASHAGPANTH LKSENDKLKIALTQSAANVKKWEIELQTLR ESNARLTTALQESAASVEQWKRQFSICRDE NDRLRNKIDELEEQCSEINREKEKNTQLKR RIEELEAELREKETE
Species Reactivity:

Human

Applications:
Uses:This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.
Dilutions:ELISA, Western Blot
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Store at -20 °C. Avoid freeze-thaw cycles.
Buffer:1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: HOMER2
Entrez9455 (Human)
Swiss ProtNP_004830.2 (Human)
 
Background:

This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein may be involved in cell growth. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with HOMER2

HOMER2 Antibody Images (3)
Western Blot analysis of HOMER2 expression in transfected 293T cell line by HOMER2 MaxPab rabbit polyclonal antibody.

Lane 1: HOMER2 transfected lysate(39.50 KDa).
Lane 2: Non-transfected lysate.
HOMER2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HOMER2 expression in mouse brain.
HOMER2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HOMER2 expression in A-431.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about HOMER2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HOMER2 Antibody PairH00009455-PW1HuIP, WB

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HOMER2 LysateNBL1-11656WB(1)

HOMER2 LysateH00009455-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HOMER2 Recombinant ProteinH00009455-P01HuELISA, WB(1)

Primary Antibodies (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HOMER2 AntibodyNBP1-85487HuIF, IHC-P, WB(3)

HOMER2 AntibodyNB100-98712Hu, Mu, RtIHC-Fr, IHC-P, WB(6)

HOMER2 AntibodyH00009455-B01PHuELISA, WB(2)

HOMER2 AntibodyH00009455-D01Hu, MuIP, WB

HOMER2 AntibodyNBP1-31861HuWB

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer

HOMER2 in Context


Novus Explorer for HOMER2 gene

Try our bioinformatic tool that shows the relationships between HOMER2 and other genes, diseases, pathways and post-translational modifications.