HOMER2 Antibody (H00009455-B01P)
HOMER2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ACPD antibody, anti-Vesl-2 antibody, anti-HOMER-2 antibody, anti-CPD antibody |
|
|
HOMER2 Antibody Summary: | | Gene: | HOMER2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | HOMER2 - homer homolog 2 (Drosophila), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HOMER2 Products HOMER2 Antibody Details: | Immunogen: | HOMER2 (NP_004830.2, 1 a.a. ~ 343 a.a) full-length human protein. |
|---|
| Epitope: | MGEQPIFTTRAHVFQIDPNTKKNWMPASKQ AVTVSYFYDVTRNSYRIISVDGAKVIINST ITPNMTFTKTSQKFGQWADSRANTVFGLGF SSEQQLTKFAEKFQEVKEAAKIAKDKTQEK IETSSNHSQASSVNGTDDEKASHAGPANTH LKSENDKLKIALTQSAANVKKWEIELQTLR ESNARLTTALQESAASVEQWKRQFSICRDE NDRLRNKIDELEEQCSEINREKEKNTQLKR RIEELEAELREKETE |
|---|
| Uses: | Antibody reactive against tissue lysate and transfected lysate in western blot. May also be used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein may be involved in cell growth. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (10)
|
Jump to: Images, Ask a Question
|
Working with HOMER2
HOMER2 Antibody Images (2) Western Blot analysis of HOMER2 expression in transfected 293T cell line by HOMER2 MaxPab polyclonal antibody.
Lane 1: HOMER2 transfected lysate(37.73 KDa).
Lane 2: Non-transfected lysate.
|  HOMER2 MaxPab polyclonal antibody. Western Blot analysis of HOMER2 expression in rat brain. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about HOMER2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (6)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| HOMER2 in Context
|
Novus Explorer for HOMER2 gene
|
|
