HNF4 alpha Antibody 0.1 ml

HNF4 alpha NBP1-89679

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-89679

  • HNF4 alpha Primary Antibodies
  • All HNF4 alpha Products
  • 1 Publication
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-89679

Catalog NumberNBP1-89679
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

HNF4 alpha Antibody Summary

 
Species Human
Predicted Species Mouse (91%), Rat (92%). Backed by our 100% guarantee.
Tested Applications WB, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene HNF4A
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

HNF4 alpha Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVAN TMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLP GAVATIVKPLSAIPQPTITKQEV

Species Reactivity

 
Human. Predicted cross-reactivity based on sequence identity: Mouse(91%), Rat(92%)

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:2000
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes

For IHC-Paraffin HIER pH6 retrieval is recommended.

Positive Controls

1 Positive Control

Product PDFs

Reviews

Earn rewards points by submitting your review for HNF4 alpha Antibody (NBP1-89679).
Submit a Review

Publications

HNF4 alpha Antibody (NBP1-89679) has been mentioned in at least 1 publication.
Earn rewards if you have published using HNF4 alpha Antibody (NBP1-89679).
Submit a Publication

Controls & Support Products

Research Tools

View all HNF4 alpha Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol HNF4A
Entrez
Uniprot

Alternate Names for HNF4 alpha

 
  • transcription factor-14
  • FLJ39654
  • hepatocyte nuclear factor 4-alpha
  • MODY1
  • hepatic nuclear factor 4 alpha
  • TCF-14
  • TCF
  • HNF-4-alpha
  • NR2A21
  • Transcription factor HNF-4
  • MODY
  • Transcription factor 14
  • HNF4alpha10/11/12
  • Nuclear receptor subfamily 2 group A member 1
  • TCF14HNF4alpha
  • NR2A1HNF4a9
  • HNF4HNF4a8
  • HNF4a7
  • hepatocyte nuclear factor 4, alpha

Related Products by Gene