HNF4 alpha Antibody (H00003172-M04)
HNF4 alpha Antibody (4E2)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-FLJ39654 antibody, anti-TCF14 antibody, anti-TCF antibody, anti-NR2A21 antibody, anti-NR2A1 antibody, anti-MODY1 antibody, anti-MODY antibody, anti-HNF4a9 antibody, anti-HNF4a8 antibody, anti-HNF4a7 antibody, anti-HNF4 antibody, |
|
|
HNF4 alpha Antibody (4E2) Summary: | | Gene: | HNF4A |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HNF4 alpha Products HNF4 alpha Antibody (4E2) Details: | Clone: | 4E2 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | HNF4A (NP_000448, 324 a.a. ~ 424 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | NDRQYDSRGRFGELLLLLPTLQSITWQMIE QIQFIKLFGMAKIDNLLQEMLLGGSPSDAP HAHHPLHPHLMQEHMGTNVIVANTMPTHLS NGQMCEWPRP* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500,
RNAi Validation |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.
|
Images (6) Reviews (0) Related Products (29) Exploring HNF4 alpha
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (17)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| HNF4 alpha Antibody | NBP1-89679 | Hu | IF, IHC-P, WB | (2) | | | | | HNF4 alpha Antibody (EPR3648) | NBP1-42081 | Hu | FACS, ICC, IHC-P, IP, WB | | | | | | HNF4 alpha Antibody (3C6) | H00003172-M07 | Hu | ELISA, IF, WB | (3) | | | | | HNF4 alpha [p Ser313] Antibody | NBP1-64746 | Hu, Mu, Rt | ELISA, IF, IHC, WB | | | | | | HNF4 alpha Antibody | NBP1-68773 | Ca, Hu, Po | IHC, PEP-ELISA | | | | | | ... and 12 more. See All » |
RNAi (7)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of monoclonal antibody to HNF4A (H00003172-M04) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00003172-M04-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to HNF4A (H00003172-M04) on HeLa cell . [antibody concentration 10 ug/ml]")
