HMW Kininogen Antibody (H00003827-B01P)
HMW Kininogen Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-BDK antibody, anti-KNG antibody |
|
|
HMW Kininogen Antibody Summary: | | Gene: | KNG1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | KNG1 - kininogen 1, |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HMW Kininogen Products HMW Kininogen Antibody Details: | Immunogen: | KNG1 (NP_000884.1, 1 a.a. ~ 427 a.a) full-length human protein. |
|---|
| Epitope: | MKLITILFLCSRLLLSLTQESQSEEIDCND KDLFKAVDAALKKYNSQNQSNNQFVLYRIT EATKTVGSDTFYSFKYEIKEGDCPVQSGKT WQDCEYKDAAKAATGECTATVGKRSSTKFS VATQTCQITPAEGPVVTAQYDCLGCVHPIS TQSPDLEPILRHGIQYFNNNTQHSSLFMLN EVKRAQRQVVAGLNFRITYSIVQTNCSKEN FLFLTPDCKSLWNGDTGECTDNAYIDIQLR IASFSQNCDIYPGKD |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: High molecular weight kininogen (HMWK) plays an important role in assembly of the plasma kallikrein (see MIM 147910)-kinin system. The KNG1 gene generates both HMWK and low molecular weight kininogen (LMWK) through alternative splicing. Both HMWK and LMWK contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, HMWK contains a 56-kD light chain that consists of domains 5 and 6H, whereas LMWK contains a unique 4-kD light chain that consists of domain 5L. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (BK) nonapeptide. BK, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see MIM 601699) from endothelial cells. During vascular damage, BK stimulates smooth muscle proliferation and intimal hypertrophy. Release of BK from HMWK generates a 2-chain HMWK, termed HMWKa, containing the heavy and light chains joined by a disulfide bond (Merkulov et al., 2008 [PubMed 18000168]).[supplied by OMIM]
|
Images (2) Reviews (0) Related Products (14) Exploring HMW Kininogen Working with HMW Kininogen
|
Jump to: Publications, Images, Ask a Question
|
Working with HMW Kininogen
HMW Kininogen Antibody Images (2) Western Blot analysis of KNG1 expression in transfected 293T cell line by KNG1 MaxPab polyclonal antibody.
Lane 1: KNG1 transfected lysate(46.97 KDa).
Lane 2: Non-transfected lysate.
|  KNG1 MaxPab polyclonal antibody. Western Blot analysis of KNG1 expression in human pancreas. |
|
|
|
Publications (1)
|
|
|
Ask a Scientist
Can't find an answer to your question about HMW Kininogen? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (6)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| HMW Kininogen in Context
Research Areas related to HMW Kininogen (2): |
|
Novus Explorer for HMW Kininogen gene
|
|
