HMW Kininogen Antibody (H00003827-M02)

HMW Kininogen Antibody (4A1)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
HMW Kininogen Antibody (4A1) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:KNG1
Purity:IgG purified
Host:Mouse
Specificity:KNG1 - kininogen 1 (4A1)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional HMW Kininogen Products
HMW Kininogen Antibody (4A1) Details:
Clone:4A1
Isotype:IgG2a Kappa
Immunogen:KNG1 (NP_000884, 322 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:VARETTCSKESNEELTESCETKKLGQSLDC NAEVYVVPWEKKIYPTVNCQPLGMISLMKR PPGFSPFRSSRIGEIKEETTSHLRSCEYKG RPPKAGAEPASEREVS*
Species Reactivity:

Human.

Applications:
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: KNG1
Entrez3827 (Human)
Swiss ProtNP_000884 (Human)
 
Background:

High molecular weight kininogen (HMWK) plays an important role in assembly of the plasma kallikrein (see MIM 147910)-kinin system. The KNG1 gene generates both HMWK and low molecular weight kininogen (LMWK) through alternative splicing. Both HMWK and LMWK contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, HMWK contains a 56-kD light chain that consists of domains 5 and 6H, whereas LMWK contains a unique 4-kD light chain that consists of domain 5L. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (BK) nonapeptide. BK, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see MIM 601699) from endothelial cells. During vascular damage, BK stimulates smooth muscle proliferation and intimal hypertrophy. Release of BK from HMWK generates a 2-chain HMWK, termed HMWKa, containing the heavy and light chains joined by a disulfide bond (Merkulov et al., 2008 [PubMed 18000168]).[supplied by OMIM]

Jump to: Ask a Question

Working with HMW Kininogen

HMW Kininogen Antibody (4A1) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about HMW Kininogen? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HMW Kininogen Antibody PairH00003827-PW1HuIP, WB

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HMW Kininogen LysateH00003827-T01HuWB(2)

HMW Kininogen LysateNBL1-12368WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HMW Kininogen Recombinant ProteinH00003827-P01HuELISA, WB(1)

HMW Kininogen Partial Recombinant ProteinH00003827-Q01HuELISA, WB(1)

Primary Antibodies (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HMW Kininogen AntibodyNBP1-31340HuIF, WB(2)

HMW Kininogen AntibodyH00003827-B01PHuELISA, WB(2)(1)

HMW Kininogen AntibodyH00003827-D01Hu, MuIP, WB

HMW Kininogen AntibodyNBP1-53176HuWB(1)

HMW Kininogen AntibodyH00003827-D01PHu, MuELISA, WB

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HMW Kininogen RNAiH00003827-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

HMW Kininogen in Context


Research Areas related to HMW Kininogen (2):
Novus Explorer for HMW Kininogen gene

Try our bioinformatic tool that shows the relationships between KNG1 and other genes, diseases, pathways and post-translational modifications.