HDAC9 Antibody (H00009734-M01)

HDAC9 Antibody (2G10)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
HDAC9 Antibody (2G10) Summary:
Species:Hu
Applications:ELISA
Clonality:Monoclonal
Gene:HDAC9
Purity:IgG purified
Host:Mouse
Specificity:HDAC9 - histone deacetylase 9
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional HDAC9 Products
HDAC9 Antibody (2G10) Details:
Clone:2G10
Isotype:IgG1 Kappa
Immunogen:HDAC9 (NP_478056, 481 a.a. ~ 571 a.a) partial recombinant protein with GST tag.
Epitope:QIHMNKLLSKSIEQLKQPGSHLEEAEEELQ GDQAMQEDRAPSSGNSTRSDSSACVDDTLG QVGAVKVKEEPVDSDEDAQIQEMESGEQAA *
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.
Dilutions:ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: HDAC9
Entrez9734 (Human)
OMIM606543 (Human)
Swiss ProtNP_478056 (Human)
 
Background:

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene has sequence homology to members of the histone deacetylase family. This gene is orthologous to the Xenopus and mouse MITR genes. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. This encoded protein may play a role in hematopoiesis. Multiple alternatively spliced transcripts have been described for this gene but the full-length nature of some of them has not been determined.

Jump to: Images, Ask a Question

Working with HDAC9

HDAC9 Antibody (2G10) Images (1)
Detection limit for recombinant GST tagged HDAC9 is approximately 0.1ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about HDAC9? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC9 LysateNBL1-11486WB

HDAC9 LysateH00009734-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC9 Recombinant ProteinH00009734-P01HuELISA, WB(1)

HDAC9 Partial Recombinant ProteinH00009734-Q01HuELISA, WB(1)

Primary Antibodies (10)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC9 Antibody (EPR5223)NBP1-95804Hu, RtICC, IF, IHC-P, WB(3)

HDAC9 AntibodyNBP1-83274HuIF, IHC-P, WB(1)

HDAC9 AntibodyNB100-91808HuELISA, IF, IHC-P, WB(2)

HDAC9 AntibodyPAB8755Hu, Mu, RtIF, IP, WB

HDAC9 AntibodyPAB2338HuELISA, IF, IHC-P, IP, WB

... and 5 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC9 RNAiH00009734-R03Hu(1)(4)

HDAC9 RNAiH00009734-R02Hu(1)(4)

HDAC9 RNAiH00009734-R05Hu(1)(4)

HDAC9 RNAiH00009734-R01Hu(1)(4)

HDAC9 RNAiH00009734-R04Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

HDAC9 in Context


Research Areas related to HDAC9 (3):
Novus Explorer for HDAC9 gene

Try our bioinformatic tool that shows the relationships between HDAC9 and other genes, diseases, pathways and post-translational modifications.