HDAC6 Antibody (H00010013-M13)

HDAC6 Antibody (3A6)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
HDAC6 Antibody (3A6) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:HDAC6
Purity:IgG purified
Host:Mouse
Specificity:HDAC6 - histone deacetylase 6 (3A6)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional HDAC6 Products
HDAC6 Antibody (3A6) Details:
Clone:3A6
Isotype:IgG1 Kappa
Immunogen:HDAC6 (AAH13737, 1 a.a. ~ 1064 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:METTQYMNEGELRVLADTYDSVYLHPNSYS CACLASGSVLRLVDAVLGAEIRNGMAIIRP PGHHAQHSLMDGYCMFNHVAVAARYAQQKH RIRRVLIVDWDVHHGQGTQFTFDQDPSVLY FSIHRYEQGRFWPHLKASNWSTTGFGQGQG YTINVPWNQVGMRDADYIAAFLHVLLPVAL EFQPQLVLVAAGFDALQGDPKGEMAATPAG FAQLTHLLMGLAGGKLILSLEGGYNLRALA EGVSASLHTLLGDPC
Species Reactivity:

Human.

Applications:
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: HDAC6
Entrez10013 (Human)
Swiss ProtAAH13737 (Human)
 
Background:

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq]

Jump to: Ask a Question

Working with HDAC6

HDAC6 Antibody (3A6) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about HDAC6? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC6 LysateH00010013-T01HuWB(2)

HDAC6 LysateNBL1-11484WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC6 Recombinant ProteinH00010013-P01HuELISA, WB(1)

HDAC6 Partial Recombinant ProteinH00010013-Q01HuELISA, WB(1)

Primary Antibodies (20)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC6 AntibodyNBP1-78981HuICC, IF, IHC (-), WB (-)(1)

HDAC6 AntibodyNBP1-82212HuIF, IHC-P, WB(3)

HDAC6 AntibodyNB100-91805Hu, Mu, RtELISA, IF, IHC-P, WB(2)(1)

HDAC6 AntibodyNBP1-61625Hu, MuELISA, IF, IHC, WB(3)

HDAC6 Antibody (EPR1698(2))NBP1-95761HuICC, IHC-P, IP, WB(2)

... and 15 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
HDAC6 RNAiH00010013-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

HDAC6 in Context


Research Areas related to HDAC6 (6):
Novus Explorer for HDAC6 gene

Try our bioinformatic tool that shows the relationships between HDAC6 and other genes, diseases, pathways and post-translational modifications.