HDAC3 Antibody (H00008841-M03)
HDAC3 Antibody (2A3)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HD3 antibody, anti-RPD3-2 antibody, anti-RPD3 antibody, |
|
|
HDAC3 Antibody (2A3) Summary: | | Gene: | HDAC3 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | HDAC3 - histone deacetylase 3 (2A3) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HDAC3 Products HDAC3 Antibody (2A3) Details: | Clone: | 2A3 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | HDAC3 (NP_003874, 319 a.a. ~ 429 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | ISEELPYSEYFEYFAPDFTLHPDVSTRIEN QNSRQYLDQIRQTIFENLKMLNHAPSVQIH DVPADLLTYDRTDEADAEERGPEENYSRPE APNEFYDGDHDNDKESDVEI* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
|
Images (5) Reviews (0) Related Products (33) Exploring HDAC3
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (3)Peptides and ProteinsPrimary Antibodies (20)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| HDAC3 Antibody | NB500-126 | Hu, Mu, Rt | ChIP, IHC-P, IP, WB | (1) | (6) | | | | HDAC3 Antibody (Y415) | NB110-57033 | Hu, Mu, Rt | ICC, IHC-P, IP, WB | (3) | (2) | | | | HDAC3 Antibody | NB100-79798 | Hu, Mu | IHC-P, IP, WB | (2) | | | | | HDAC3 Antibody | NBP1-67592 | Hu, Mu, Rt | ELISA, IF, IHC, WB | (3) | | | | | HDAC3 Antibody | NBP1-61624 | Hu, Mu, Rt | ELISA, IF, IHC, WB | (3) | | | | | ... and 15 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of monoclonal antibody to HDAC3 (H00008841-M03) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00008841-M03-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to HDAC3 (H00008841-M03) on HeLa cell . [antibody concentration 10 ug/ml]")
