HBLD1 Antibody (H00122961-B01P)
HBLD1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HBLD1 antibody, anti-ISA2 antibody, anti-c14_5557 antibody, |
|
|
HBLD1 Antibody Summary: | | Gene: | ISCA2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | Reacts with iron-sulfur cluster assembly 2 homolog (S. cerevisiae). |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HBLD1 Products HBLD1 Antibody Details: | Immunogen: | ISCA2 (NP_919255.1, 1 a.a. ~ 154 a.a) full-length human protein. |
|---|
| Epitope: | MAAAWGSSLTAATQRAVTPWPRGRLLTASL GPQARREASSSSPEAGEGQICLTDSCVQRL LEITEGSEFLRLQVEGGGCSGFQYKFSLDT VINPDDRVFEQGGARVVVDSDSLAFVKGAQ VDFSQELIRSSFQVLNNPQAQQGCSCGSSF SIKL |
|---|
| Uses: | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (0) Related Products (7)
|
Jump to: Images, Ask a Question
|
Working with HBLD1
HBLD1 Antibody Images (1) Western Blot analysis of HBLD1 expression in transfected 293T cell line by HBLD1 MaxPab polyclonal antibody.
Lane 1: HBLD1 transfected lysate(16.94 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about HBLD1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (3)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
