Home » KAT2A/GCN5 » KAT2A/GCN5 Proteins » Recombinant Human KAT2A/GCN5 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human KAT2A/GCN5 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related KAT2A/GCN5 Peptides and Proteins

Order Details


    • Catalog Number
      H00002648-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human KAT2A/GCN5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human GCN5L2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Protein/Peptide Type
Partial Recombinant Protein
Gene
KAT2A

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KAT2A/GCN5 Protein

  • EC 2.3.1.48
  • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
  • GCN5L2
  • GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
  • GCN5MGC102791
  • General control of amino acid synthesis protein 5-like 2
  • General control of amino acid synthesis, yeast, homolog-like 2
  • HGCN5
  • Histone acetyltransferase GCN5
  • histone acetyltransferase KAT2A
  • hsGCN5
  • K(lysine) acetyltransferase 2A
  • KAT2A
  • KAT2A/GCN5
  • Lysine acetyltransferase 2A
  • PCAF-B
  • STAF97

Background

GCN5L2 - GCN5 general control of amino-acid synthesis 5-like 2 (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCAF Antibody
(5E11) - Azide and BS ...
H00008850-M04
Immunocytochemistry/ Immunofluorescence PCAF Antibody (5E11) - Azide and BSA Free
Sandwich ELISA PCAF Antibody (5E11) - Azide and BSA Free
Western Blot PCAF Antibody (5E11) - Azide and BSA Free
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Airway
Trypsin-like Protease ...
2695-SE
Airway Trypsin-like Protease/HAT/TMPRSS11D
(4 Publications)
Species: Hu
Applications: EnzAct
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(35 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(15 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
CBP/KAT3A Antibody
- BSA Free
NB100-381
Western Blot CBP/KAT3A Antibody - BSA Free
Immunoprecipitation CBP/KAT3A Antibody - BSA Free
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
ADA2a Antibody -
BSA Free
NBP2-92547
Western Blot ADA2a Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, WB
PAG1 Antibody
(PAG-C1) - BSA Free
NB500-487
Immunohistochemistry-Paraffin PAG1 Antibody (PAG-C1) - BSA Free
Immunoprecipitation PAG1 Antibody (PAG-C1) - BSA Free
(1 Publication)
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
Opsin 1 (Long
Wave) Antibody - BSA
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody - BSA Free
Species: Hu, Mu
Applications: WB
eIF4E Antibody
(299910) [Unconjugate
MAB3228
Western Blot eIF4E Antibody (299910) [Unconjugated]
Immunocytochemistry eIF4E Antibody (299910) [Unconjugated]
Knockout Validated eIF4E Antibody (299910) [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
TADA3L Antibody -
BSA Free
NBP1-90243
Immunohistochemistry TADA3L Antibody - BSA Free
Immunohistochemistry TADA3L Antibody - BSA Free
Immunohistochemistry TADA3L Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
Adenosine
Deaminase/ADA Antibod ...
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody - BSA Free
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
TIP60 Antibody -
BSA Free
NBP1-85482
Immunocytochemistry/ Immunofluorescence TIP60 Antibody - BSA Free
Western Blot TIP60 Antibody - BSA Free
Immunohistochemistry-Paraffin TIP60 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
TRRAP Antibody
AF7365
Western Blot TRRAP Antibody
Species: Hu, Mu, Rt
Applications: WB
HDAC1 Antibody -
BSA Free
NB100-56340
Western Blot HDAC1 Antibody - BSA Free
Simple Western HDAC1 Antibody - BSA Free
Western Blot HDAC1 Antibody - BSA Free
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
SPT3 Antibody
(OTI1A5)
NBP2-45466
Immunohistochemistry SPT3 Antibody (OTI1A5)
Immunohistochemistry SPT3 Antibody (OTI1A5)
Immunohistochemistry SPT3 Antibody (OTI1A5)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PAGE, WB
Recombinant Human
KAT2A/GCN5 Protein
H00002648-Q01
Recombinant Human KAT2A/GCN5 Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for KAT2A/GCN5 Partial Recombinant Protein (H00002648-Q01) (0)

There are no publications for KAT2A/GCN5 Partial Recombinant Protein (H00002648-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT2A/GCN5 Partial Recombinant Protein (H00002648-Q01) (0)

There are no reviews for KAT2A/GCN5 Partial Recombinant Protein (H00002648-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KAT2A/GCN5 Partial Recombinant Protein (H00002648-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KAT2A/GCN5 Products

Blogs on KAT2A/GCN5

There are no specific blogs for KAT2A/GCN5, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KAT2A/GCN5 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol KAT2A