GTF2H2 Antibody (H00002966-B01)

GTF2H2 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
GTF2H2 Antibody Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Polyclonal
Gene:GTF2H2
Purity:Whole antisera
Host:Mouse
Specificity:GTF2H2 - general transcription factor IIH, polypeptide 2, 44kDa,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional GTF2H2 Products
GTF2H2 Antibody Details:
Immunogen:GTF2H2 (-, 1 a.a. ~ 395 a.a) full-length human protein.
Epitope:MDEEPERTKRWEGGYERTWEILKEDESGSL KATIEDILFKAKRKRVFEHHGQVRLGMMRH LYVVVDGSRTMEDQDLKPNRLTCTLKLLEY FVEEYFDQNPISQIGIIVTKSKRAEKLTEL SGNPRKHITSLKKAVDMTCHGEPSLYNSLS IAMQTLKHMPGHTSREVLIIFSSLTTCDPS NIYDLIKTLKAAKIRVSVIGLSAEVRVCTV LARETGGTYHVILDESHYKELLTHHVSPPP ASSSSECSLIRMGFP
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. Has also been used for immunofluorescence.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: GTF2H2
Entrez2966 (Human)
Swiss ProtNP_001506.1 (Human)
 
Background:

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.

Jump to: Images, Ask a Question

Working with GTF2H2

GTF2H2 Antibody Images (3)
GTF2H2 MaxPab polyclonal antibody. Western Blot analysis of GTF2H2 expression in human pancreas.Immunofluorescence of purified MaxPab antibody to GTF2H2 on HepG2 cell. [antibody concentration 10 ug/ml]
Western Blot analysis of GTF2H2 expression in transfected 293T cell line by GTF2H2 MaxPab polyclonal antibody (B01).

Lane 1: GTF2H2 transfected lysate(44.40 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about GTF2H2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
GTF2H2 Antibody PairH00002966-PW1HuIP, WB

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
GTF2H2 LysateH00002966-T01HuWB(2)

GTF2H2 LysateH00002966-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
GTF2H2 Recombinant ProteinH00002966-P01HuELISA, WB(1)

Primary Antibodies (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
GTF2H2 AntibodyNBP1-19596Hu, Mu, RtIF, IHC-P, WB(1)

GTF2H2 AntibodyNBP1-68038Hu, Mu, RtELISA, WB(1)

GTF2H2 AntibodyH00002966-B01PHuFunc, IF, WB

GTF2H2 AntibodyH00002966-D01HuIP

GTF2H2 AntibodyH00002966-D01PHuWB

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
GTF2H2 RNAiH00002966-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

GTF2H2 in Context


Research Areas related to GTF2H2 (1):
Novus Explorer for GTF2H2 gene

Try our bioinformatic tool that shows the relationships between GTF2H2 and other genes, diseases, pathways and post-translational modifications.