GRASP65 Antibody (H00064689-B01P)
GRASP65 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-FLJ23443 antibody, anti-P65 antibody, anti-MGC118897 antibody, anti-MGC118894 antibody, anti-GRASP65 antibody, anti-GOLPH5 antibody, |
|
|
GRASP65 Antibody Summary: | | Gene: | GORASP1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | GORASP1 - golgi reassembly stacking protein 1, 65kDa, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional GRASP65 Products GRASP65 Antibody Details: | Immunogen: | GORASP1 (NP_114105.1, 1 a.a. ~ 440 a.a) full-length human protein. |
|---|
| Epitope: | MGLGVSAEQPAGGAEGFHLHGVQENSPAQQ AGLEPYFDFIITIGHSRLNKENDTLKALLK ANVEKPVKLEVFNMKTMRVREVEVVPSNMW GGQGLLGASVRFCSFRRASEQVWHVLDVEP SSPAALAGLRPYTDYVVGSDQILQESEDFF TLIESHEGKPLKLMVYNSKSDSCREVTVTP NAAWGGEGSLGCGIGYGYLHRIPTQPPSYH KKPPGTPPPSALPLGAPPPDALPPGPTPED SPSLETGSRQSDYME |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (9) Exploring GRASP65
|
Jump to: Images, Ask a Question
|
Working with GRASP65
GRASP65 Antibody Images (1) Western Blot analysis of GORASP1 expression in transfected 293T cell line by GORASP1 MaxPab polyclonal antibody.
Lane 1: GORASP1 transfected lysate(48.4 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about GRASP65? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (4)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
