GLTSCR2 Antibody (H00029997-B01P)
GLTSCR2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-PICT-1 antibody, anti-PICT1 antibody, |
|
|
GLTSCR2 Antibody Summary: | | Gene: | GLTSCR2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | Reacts with glioma tumor suppressor candidate region gene 2. |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional GLTSCR2 Products GLTSCR2 Antibody Details: | Immunogen: | GLTSCR2 (NP_056525.1, 1 a.a. ~ 478 a.a) full-length human protein. |
|---|
| Epitope: | MAAGGSGVGGKRSSKSDADSGFLGLRPTSV DPALRRRRRGPRNKKRGWRRLAQEPLGLEV DQFLEDVRLQERTSGGLLSEAPNEKLFFVD TGSKEKGLTKKRTKVQKKSLLLKKPLRVDL ILENTSKVPAPKDVLAHQVPNAKKLRRKEQ LWEKLAKQGELPREVRRAQARLLNPSATRA KPGPQDTVERPFYDLWASDNPLDRPLVGQD EFFLEQTKKKGVKRPARLHTKPSQAPAVEV APAGASYNPSFEDHQ |
|---|
| Uses: | This antibody is reactive against transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500, |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (2) Reviews (0) Related Products (10) Exploring GLTSCR2
|
Jump to: Images, Ask a Question
|
Working with GLTSCR2
GLTSCR2 Antibody Images (2) Western Blot analysis of GLTSCR2 expression in transfected 293T cell line by GLTSCR2 MaxPab polyclonal antibody.
Lane 1: GLTSCR2 transfected lysate(52.58 KDa).
Lane 2: Non-transfected lysate.
|  Immunofluorescence of purified MaxPab antibody to GLTSCR2 on HeLa cell. [antibody concentration 10 ug/ml] |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about GLTSCR2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
