We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant GFP Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GFP Peptides and Proteins

Order Details


    • Catalog Number
      P4992
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant GFP Protein Summary

Description
A full-length recombinant protein corresponding to the amino acids 1 - 238 of GFP

Source: Escherichia coli

Amino Acid Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Preparation
Method
Escherichia coli expression system
Protein/Peptide Type
Recombinant Protein

Applications/Dilutions

Dilutions
  • SDS-Page
Application Notes
This product is useful for SDS-PAGE.

Reactivity Notes

Jellyfishes

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
In 20 mM Tris-HCl, pH 8.0 (10% glycerol)
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant GFP Protein

  • eGFP
  • Enhanced Green Fluorescent Protein
  • GFP
  • GFPuv
  • green fluorescent protein (gfp)
  • Green Fluorescent Protein

Background

Green fluorescent protein (GFP) is a 27 kDa protein derived from the bioluminescent jellyfish Aquorea Victoria. GFP can be excited by light in the blue to ultraviolet spectrum and has an excitation peak at 395 nm with an emission peak at 509 nm in the green spectrum. GFP autocatalytically forms a fluorescent pigment from natural amino acids present in the nascent protein. GFP is widely used as a reporter (tag) for gene expression, enabling researchers to visualize and localize GFP-tagged proteins within living cells without the need for chemical staining. GFP fluorescence is stable under fixation conditions and antibodies are suitable for a variety of applications including ELISA, ICC/IF, IHC, IP and WB (1-3).

References
1. Shi, C., Pan, F. C., Kim, J. N., Washington, M. K., Padmanabhan, C., Meyer, C. T., . . . Means, A. L. (2019). Differential Cell Susceptibilities to Kras(G12D) in the Setting of Obstructive Chronic Pancreatitis. Cell Mol Gastroenterol Hepatol. doi:10.1016/j.jcmgh.2019.07.001

2. Zhao, S., Fortier, T. M., & Baehrecke, E. H. (2018). Autophagy Promotes Tumor-like Stem Cell Niche Occupancy. Curr Biol, 28(19), 3056-3064.e3053. doi:10.1016/j.cub.2018.07.075

3. Zusso, M., Lunardi, V., Franceschini, D., Pagetta, A., Lo, R., Stifani, S., . . . Moro, S. (2019). Ciprofloxacin and levofloxacin attenuate microglia inflammatory response via TLR4/NF-kB pathway. J Neuroinflammation, 16(1), 148. doi:10.1186/s12974-019-1538-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for GFP Recombinant Protein (P4992) (0)

There are no publications for GFP Recombinant Protein (P4992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFP Recombinant Protein (P4992) (0)

There are no reviews for GFP Recombinant Protein (P4992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GFP Recombinant Protein (P4992). (Showing 1 - of FAQ).

    Additional GFP Products

    Research Areas for GFP Recombinant Protein (P4992)

    Find related products by research area.

    Blogs on GFP. Showing 1-10 of 13 blog posts - Show all blog posts.

    Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
    Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

    Autophagy and RAS signaling: Clinical implications
    By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ...  Read full blog post.

    Neurovascular signaling for repair enhances brain metastasis
    By Jamshed Arslan, Pharm. D., PhD. Stroke    is a leading cause of mortality and morbidity worldwide. Cellular players – neurons, astrocytes, endothelial and stromal cells – involved in post-stroke repair t...  Read full blog post.


      Read full blog post.

    How to visualize autophagy by microscopy
    By Christina Towers, PhD Autophagy is a recycling process that relies on the formation of a unique organelle termed an autophagosome. An elegant way to monitor autophagy is through various microscopy techniques to...  Read full blog post.

    Toll-like receptors in the intestinal epithelial cells
    By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ...  Read full blog post.


      Read full blog post.

    Animal Models to Study Autophagy
    By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the...  Read full blog post.

    The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
    GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

    GFP - Be Green!
    Green fluorescence protein (GFP) is a 27KD protein derived from the jellyfish Aquorea victoria that emits a green light (emission peak at a wavelength of 509 nm) when excited by blue light (excitation peak at a wavelength of 395 nm). GFP is a highly v...  Read full blog post.

    Showing 1-10 of 13 blog posts - Show all blog posts.

    Contact Information

    Product PDFs

    Calculators

    Concentration Calculator

    The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

    =
    ÷

    Review this Product

    Be the first to review our Recombinant GFP Protein and receive a gift card or discount.