GDF11 Antibody (1E6) 0.1 mg

GDF11 H00010220-M03

Contact Information

Choose a country to view pricing and purchasing information.

More on H00010220-M03

Ordering Information: H00010220-M03

Catalog NumberH00010220-M03
  • FormUnconjugated
  • Size(s)0.1 mg
  • Price, Shipping
    & Availability
     

     
  •  

GDF11 Antibody (1E6) Summary

 
Species Human
Tested Applications WB, ELISA, S-ELISA
Clonality Monoclonal
Host Mouse
Gene GDF11
Purity IgG purified
Specificity GDF11 (1E6)
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

GDF11 Antibody (1E6) Details

 
Clone 1E6
Isotype IgG2a Kappa
Immunogen GDF11 (NP_005802, 310 a.a. ~ 408 a.a) partial recombinant protein with GST tag.ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMF MQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIY GKIPGMVVDRCGCS

Species Reactivity

 
Other species not tested.

Applications/Dilutions

 
Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Sandwich ELISA 1:100-1:2000
Application Notes

Antibody reactive against cell lysate for western blot. It has also been used for ELISA.

Product PDFs

Reviews

Earn rewards points by submitting your review for GDF11 Antibody (H00010220-M03).
Submit a Review

Publications

Earn rewards if you have published using GDF11 Antibody (H00010220-M03).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all GDF11 Research Tools.

Notes

 
This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

 
Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer In 1x PBS, pH 7.4
Unit Size 0.1 mg
Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol GDF11
Entrez
OMIM
Uniprot

Alternate Names for GDF11

 
  • growth/differentiation factor 11
  • GDF-11
  • BMP-11BMP11Bone morphogenetic protein 11
  • growth differentiation factor 11

Related Products by Gene

Background

 
The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development.