| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 31-117 of Human GABARAPL2 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | GABARAPL2 |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
![Immunohistochemistry ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Immunohistochemistry_10631.jpg)
![Simple Western ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Simple_Western_16409.jpg)
![Western Blot ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Western_Blot_11614.jpg)
Research Areas for GATE-16/GABARAPL2 Partial Recombinant Protein (H00011345-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GABARAPL2 |
![Prolyl Oligopeptidase/PREP [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Prolyl Oligopeptidase/PREP [Unconjugated]")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)