I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence

Name: GATE-16/GABARAPL2 Antibody
Brand: Novus Biologicals
SKU: NBP1-56459
Price: 329 USD
Availability: Discontinued

Question

Accepted Answer

Here is the link using our search bar and filters

Immunogen	Synthetic peptides corresponding to GABARAPL2(GABA(A) receptor-associated protein-like 2) The peptide sequence was selected from the N terminal of GABARAPL2. Peptide sequence KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV.
Predicted Species	Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Zebrafish (92%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	GABARAPL2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	Western Blot 1:100-1:2000
Application Notes	This is a rabbit polyclonal antibody against GABARAPL2 and was validated on Western blot.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 2% Sucrose
Preservative	0.09% Sodium Azide
Purity	Immunogen affinity purified

Gene Symbol	GABARAPL2
Uniprot	P60520()

GATE-16/GABARAPL2 Antibody