GABARAPL2 Antibody Summary:

Species:	Hu
Applications:	ELISA, WB
Clonality:	Polyclonal

Gene:	GABARAPL2
Purity:	Whole antisera
Host:	Mouse

Specificity:	GABARAPL2 - GABA(A) receptor-associated protein-like 2

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional GABARAPL2 Products

Peptides and Proteins	Primary Antibodies
RNAi

» View all GABARAPL2 Related Products

GABARAPL2 Antibody Details:

Immunogen:	GABARAPL2 (NP_009216, 31 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Epitope:	VIVEKVSGSQIVDIDKRKYLVPSDITVAQF MWIIRKRIQLPSEKAIFLFVDKTVPQSSLT MGQLYEKEKDEDGFLYVAYSGENTFGF*

Species Reactivity:

Human. Other species not tested.

Applications:

Uses:	Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:	ELISA, Western Blot 1:500
Unit Size:	0.05 ml
Concentration:	This product is unpurified. Concentration is not relevant.

Notes:

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging:

Storage:	Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:	Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: GABARAPL2

Entrez	11345 (Human)
OMIM	607452, (Human)
Swiss Prot	NP_009216 (Human)

Images (1)

See all images...

Reviews (0)

Be the first to review this product for a reward!

Working with GABARAPL2

GABARAPL2 Antibody Images (1)

GABARAPL2 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of GABARAPL2 expression in 293 ( Cat # L026V1 ).

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about GABARAPL2? Ask us by using live chat or by submitting your questions below:

Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins

Name	Catalog#	Reactivity	Applications	Images
GABARAPL2 Partial Recombinant Protein	H00011345-Q01	Hu	ELISA, WB	(1)
GABARAPL2 Protein	NBP1-50966		PAGE
GABARAPL2 Protein	P3565	Hu	PAGE

Primary Antibodies (7)

Name	Catalog#	Reactivity	Applications	Images	Publications
GABARAPL2 Antibody	R-142-100	Hu, Rt	IF, IHC-Fr, WB	(6)	(1)
GABARAPL2 Antibody	NBP1-88883	Hu	IHC-P, WB	(2)
GABARAPL2 Antibody	NB110-74798	Hu, Mu, Rt	IHC-Fr, IHC-P, WB		(10)
GABARAPL2 Antibody	NB120-15858	Bv, Hu, Mu, Rt	WB	(2)	(1)
GABARAPL2 Antibody	NBP1-56459	Hu, Mu, Rt	WB	(1)
... and 2 more. See All »

RNAi (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
GABARAPL2 RNAi	H00011345-R01	Hu		(1)	(4)

Secondary Antibodies

Name	Catalog#	Reactivity	Applications	Publications
Mouse IgG Antibody [Biotin]	NB720-B	Mu	ELISA, IHC-P, WB
Mouse IgG Antibody [HRP]	NB720-H	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [Alkaline Phosphatase]	NB720-AP	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [FITC]	NB720-F	Mu	ICC, IHC-P	(2)
Mouse IgG Antibody	NB120-7056	Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)	ELISA, IHC-P, IP, WB
See All »

Jump to: Novus Explorer, Research Areas

GABARAPL2 in Context

Research Areas related to GABARAPL2 (5):

Novus Explorer for GABARAPL2 gene

Try our bioinformatic tool that shows the relationships between GABARAPL2 and other genes, diseases, pathways and post-translational modifications.

GABARAPL2 Antibody (H00011345-A01)

GABARAPL2 Antibody